4F8T: Human BTN3A3 Ectodomain

Crystal Structure of the Human BTN3A3 Ectodomain. Determined by X-ray diffraction at 2.38 Å resolution. Released 8 Aug 2012.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,666
Mol. weight: 24.45 kDa
Released: 8 Aug 2012

Explore 4F8T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F8T contains 9 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
α-helix	10	1
β-strand	11-14	4	2
β-strand	19-26	8	1
β-strand	35-40	6	2
β-strand	45-51	7	2
β-strand	54-55	2	2
α-helix	62-64	3
β-strand	68-71	4	1
α-helix	75-77	3
β-strand	79-84	6	1
α-helix	89-91	3
β-strand	93-101	9	2
β-strand	104-115	12	2
β-strand	116	1	3
α-helix	117-121	5
β-strand	122-129	8	4
β-strand	132-142	11	4
β-strand	143	1	3
β-strand	147-152	6	5
α-helix	156	1
β-strand	157-158	2	5
α-helix	159	1
β-strand	161-162	2	4
α-helix	163-165	3
β-strand	166-167	2	4
α-helix	172	1
β-strand	173-181	9	4
β-strand	189-195	7	5
β-strand	200-206	7	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 3 member A3	A	protein	226	Homo sapiens	O00478 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4F8T_1 Butyrophilin subfamily 3 member A3 (chains A)
ADLQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVE
DRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAAL
GSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAA
SVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQHHHHHH

Primary citation

The molecular basis for modulation of human V(gamma)9V(delta)2 T cell response by CD277/Butryophilin (BTN3A)-specific antibodies. Palakodeti, A., Sandstrom, A., Sundaresan, L. et al. J Biol Chem (2012) 287:32780-32790. DOI 10.1074/jbc.M112.384354 · PubMed

Other PDB entries of the same protein (UniProt O00478 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J0G 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with HMBPP
6J0L 1.95 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with sulfate…
6J0K 2.0 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with HMBPP
5ZZ3 3.0 Å, Crystal structure of intracellular B30.2 domain of BTN3A3
9II6 3.27 Å, Cryo-EM structure of the intracellular domains of BTN2A1-BTN3A1-BTN3A3
8ZJY 3.7 Å, Cryo-EM structure of pAg-bound BTN2A1-BTN3A1-BTN3A3 in complex with Vgamma9-Vdelta2 TCR…
8ZJZ 3.8 Å, Cryo-EM structure of the full-length pAg-bound BTN2A1-BTN3A1-BTN3A3 complex
8ZYR 4.07 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A3

Browse structure collections

About this viewer

MolViewer shows 4F8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.