Structure of the Cif:Nedd8 complex - Photorhabdus luminescens Cycle Inhibiting Factor in complex with human Nedd8. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Jun 2012.
Explore 4FBJ in 3D Show helices and sheets RCSB PDB PDBe
4FBJ contains 20 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 53-65 | 13 | |
| α-helix | 67-73 | 7 | |
| α-helix | 82-84 | 3 | |
| α-helix | 87-100 | 14 | |
| α-helix | 104-111 | 8 | |
| β-strand | 121 | 1 | 1 |
| α-helix | 123-135 | 13 | |
| α-helix | 143-149 | 7 | |
| β-strand | 152 | 1 | 2 |
| α-helix | 154-160 | 7 | |
| β-strand | 169-176 | 8 | 2 |
| β-strand | 181-187 | 7 | 2 |
| β-strand | 195-199 | 5 | 2 |
| β-strand | 202 | 1 | 3 |
| β-strand | 211 | 1 | 3 |
| α-helix | 213-219 | 7 | |
| α-helix | 220-222 | 3 | |
| β-strand | 224-226 | 3 | 2 |
| α-helix | 227-234 | 8 | |
| α-helix | 236-240 | 5 | |
| α-helix | 243-254 | 12 | |
| α-helix | 260-262 | 3 | |
| α-helix | 265-267 | 3 | |
| α-helix | 269 | 1 | |
| β-strand | 274-281 | 8 | 2 |
| α-helix | 283-298 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 4 |
| β-strand | 12-16 | 5 | 4 |
| β-strand | 22 | 1 | 5 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 42-45 | 4 | 4 |
| β-strand | 48-49 | 2 | 4 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 5 |
| β-strand | 66-70 | 5 | 4 |
| β-strand | 72 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hypothetical protein | A | protein | 261 | Photorhabdus luminescens subsp. laumondii | Q7N439 (AlphaFold model) |
| NEDD8 | B | protein | 88 | Homo sapiens | Q15843 (AlphaFold model) |
>4FBJ_1 Hypothetical protein (chains A) KNSINTIKLIDDIIALHNDPKGNKLLWNDNWQDKIINRDLANIFEKIDESVSELGGLEMY QEMVGVNPYDPTEPVSGLSAQNIFKLMTEGEHAVDPVEMAQTGKIDGNEFAESVDQLSSA KNYVALVNDRRLGHMFLIDIPSNDQETVGYIYQSDLGQGALPPLKIADWLNSRGKDAVSL NKLKKLLSREFNLLSDDEKRALISETLDIHKDVSNVELDRIKRDRGVDIYLTEYDVNNFY ENIETLKSKLSNYDKKLSKPK
>4FBJ_2 NEDD8 (chains B) MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK ILGGSVLHLVLALRGGGGLRQKHHHHHH
The molecular basis of Nedd8 deamidation by the bacterial effector protein Cif. Crow, A., Hughes, R.K., Taieb, F. et al. Proc Natl Acad Sci U S A (2012).
Other PDB entries of the same protein (UniProt Q7N439 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FBJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.