Catalytic domain of human PAK4 with QKFTGLPRQW peptide. Determined by X-ray diffraction at 1.97 Å resolution. Released 12 Sept 2012.
Explore 4FIH in 3D Show helices and sheets RCSB PDB PDBe
4FIH contains 22 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 299-311 | 13 | |
| α-helix | 313 | 1 | |
| α-helix | 317-319 | 3 | |
| β-strand | 321-329 | 9 | 1 |
| β-strand | 334-340 | 7 | 1 |
| β-strand | 346-353 | 8 | 1 |
| α-helix | 354-356 | 3 | |
| α-helix | 360-363 | 4 | |
| α-helix | 364-372 | 9 | |
| β-strand | 378 | 1 | 2 |
| β-strand | 381-387 | 7 | 1 |
| β-strand | 390-395 | 6 | 1 |
| β-strand | 401-402 | 2 | 2 |
| α-helix | 403-409 | 7 | |
| α-helix | 414-433 | 20 | |
| β-strand | 436-437 | 2 | 3 |
| α-helix | 443-445 | 3 | |
| β-strand | 446-448 | 3 | 2 |
| β-strand | 454-456 | 3 | 2 |
| β-strand | 463-464 | 2 | 3 |
| β-strand | 472 | 1 | 4 |
| α-helix | 479-481 | 3 | |
| α-helix | 484-487 | 4 | |
| β-strand | 492 | 1 | 4 |
| α-helix | 495-510 | 16 | |
| α-helix | 520-529 | 10 | |
| α-helix | 533-535 | 3 | |
| α-helix | 538-540 | 3 | |
| α-helix | 543-552 | 10 | |
| α-helix | 561-562 | 2 | |
| α-helix | 563-566 | 4 | |
| α-helix | 570-574 | 5 | |
| α-helix | 575-577 | 3 | |
| α-helix | 578-580 | 3 | |
| α-helix | 582-584 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase PAK 4 | A | protein | 346 | Homo sapiens | O96013 (AlphaFold model) |
>4FIH_1 Serine/threonine-protein kinase PAK 4 (chains A) MGSSHHHHHHSSGLVPRGSHMENLYFQGARARQENGMPEKPPGPRSPQREPQRVSHEQFR AALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFN EVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVL QALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPE LISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSL KGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
Type II p21-activated kinases (PAKs) are regulated by an autoinhibitory pseudosubstrate. Ha, B.H., Davis, M.J., Chen, C. et al. Proc Natl Acad Sci U S A (2012) 109:16107-16112. DOI 10.1073/pnas.1214447109 · PubMed
Other PDB entries of the same protein (UniProt O96013 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FIH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.