4FIP: Ubiquitin carboxyl-terminal hydrolase 8
Structure of the SAGA Ubp8(S144N)/Sgf11(1-72, Delta-ZnF)/Sus1/Sgf73 DUB module. Determined by X-ray diffraction at 2.69 Å resolution. Released 25 Jul 2012.
- Method
- X-ray diffraction
- Resolution
- 2.69 Å
- Organism
- Saccharomyces cerevisiae
- Chains
- 8
- Atoms
- 10,730
- Mol. weight
- 169.46 kDa
- Ligands
- ZN
- Released
- 25 Jul 2012
Explore 4FIP in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4FIP contains 65 α-helices and 67 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 22 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| α-helix | 14-32 | 19 | |
| α-helix | 36-43 | 8 | |
| β-strand | 45 | 1 | 1 |
| β-strand | 52 | 1 | 1 |
| β-strand | 57-60 | 4 | 2 |
| β-strand | 66-68 | 3 | 2 |
| α-helix | 73-81 | 9 | |
| β-strand | 85-88 | 4 | 2 |
| β-strand | 94-96 | 3 | 2 |
| β-strand | 101-102 | 2 | 2 |
| α-helix | 107-110 | 4 | |
| α-helix | 112-117 | 6 | |
| α-helix | 118-124 | 7 | |
| β-strand | 125-126 | 2 | 3 |
| α-helix | 127-129 | 3 | |
| α-helix | 146-155 | 10 | |
| α-helix | 159-166 | 8 | |
| α-helix | 169-173 | 5 | |
| α-helix | 183-195 | 13 | |
| α-helix | 214-226 | 13 | |
| α-helix | 238-255 | 18 | |
| α-helix | 261-264 | 4 | |
| α-helix | 265-269 | 5 | |
| α-helix | 274-279 | 6 | |
| β-strand | 281-288 | 8 | 4 |
| β-strand | 298-303 | 6 | 4 |
| β-strand | 306-308 | 3 | 5 |
| β-strand | 315 | 1 | 6 |
| α-helix | 316-323 | 8 | |
| β-strand | 329 | 1 | 7 |
| α-helix | 344 | 1 | |
| β-strand | 345 | 1 | 7 |
| β-strand | 346-353 | 8 | 4 |
| β-strand | 354 | 1 | 8 |
| β-strand | 357-362 | 6 | 5 |
| β-strand | 365-367 | 3 | 9 |
| β-strand | 373-375 | 3 | 9 |
| β-strand | 381 | 1 | 6 |
| β-strand | 385-387 | 3 | 5 |
| α-helix | 389-391 | 3 | |
| β-strand | 392 | 1 | 4 |
| α-helix | 405-408 | 4 | |
| β-strand | 409-420 | 12 | 5 |
| β-strand | 427-434 | 8 | 5 |
| β-strand | 438-443 | 6 | 5 |
| β-strand | 446-450 | 5 | 5 |
| α-helix | 452-455 | 4 | |
| β-strand | 460-470 | 11 | 5 |
Chain B: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-19 | 11 | |
| α-helix | 21-35 | 15 | |
| α-helix | 38-52 | 15 | |
| α-helix | 58-71 | 14 | |
| α-helix | 75-90 | 16 | |
| β-strand | 93 | 1 | 10 |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-41 | 34 | |
Chain D: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 11 | 1 | 10 |
| α-helix | 13-18 | 6 | |
| α-helix | 33-35 | 3 | |
| α-helix | 36-40 | 5 | |
| α-helix | 43-44 | 2 | |
| β-strand | 49 | 1 | 11 |
| α-helix | 51-57 | 7 | |
| β-strand | 58 | 1 | 12 |
| β-strand | 75-78 | 4 | 3 |
| β-strand | 84-86 | 3 | 3 |
| α-helix | 87-94 | 8 | |
Chain E: 20 helices, 26 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| α-helix | 14-32 | 19 | |
| α-helix | 36-43 | 8 | |
| β-strand | 45 | 1 | 13 |
| β-strand | 52 | 1 | 13 |
| β-strand | 57-60 | 4 | 14 |
| β-strand | 66-68 | 3 | 14 |
| α-helix | 73-79 | 7 | |
| β-strand | 85-88 | 4 | 14 |
| β-strand | 94-96 | 3 | 14 |
| β-strand | 101-103 | 3 | 14 |
| α-helix | 107-110 | 4 | |
| α-helix | 112-117 | 6 | |
| α-helix | 118-124 | 7 | |
| β-strand | 125-126 | 2 | 15 |
| α-helix | 127-129 | 3 | |
| α-helix | 146-156 | 11 | |
| α-helix | 159-166 | 8 | |
| α-helix | 169-173 | 5 | |
| α-helix | 183-195 | 13 | |
| α-helix | 214-226 | 13 | |
| α-helix | 228-230 | 3 | |
| α-helix | 238-256 | 19 | |
| α-helix | 274-278 | 5 | |
| β-strand | 281-288 | 8 | 16 |
| β-strand | 295-303 | 9 | 16 |
| β-strand | 306-309 | 4 | 11 |
| β-strand | 315 | 1 | 17 |
| α-helix | 316-323 | 8 | |
| β-strand | 326-335 | 10 | 16 |
| β-strand | 342-353 | 12 | 16 |
| β-strand | 354 | 1 | 12 |
| β-strand | 357-363 | 7 | 11 |
| β-strand | 365-367 | 3 | 18 |
| β-strand | 373-375 | 3 | 18 |
| β-strand | 381 | 1 | 17 |
| β-strand | 385-387 | 3 | 11 |
| α-helix | 389-391 | 3 | |
| β-strand | 392 | 1 | 16 |
| β-strand | 409-420 | 12 | 11 |
| β-strand | 427-433 | 7 | 11 |
| α-helix | 435-437 | 3 | |
| β-strand | 439-443 | 5 | 11 |
| β-strand | 446-450 | 5 | 11 |
| α-helix | 452-455 | 4 | |
| β-strand | 460-470 | 11 | 11 |
Chain F: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-19 | 11 | |
| α-helix | 21-35 | 15 | |
| α-helix | 38-52 | 15 | |
| α-helix | 58-72 | 15 | |
| α-helix | 75-92 | 18 | |
| β-strand | 93 | 1 | 19 |
Chain G: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7 | 1 | 20 |
| α-helix | 8-41 | 34 | |
Chain H: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7 | 1 | 20 |
| β-strand | 11 | 1 | 19 |
| α-helix | 13-15 | 3 | |
| α-helix | 32-35 | 4 | |
| α-helix | 36-39 | 4 | |
| β-strand | 49 | 1 | 5 |
| α-helix | 51-57 | 7 | |
| β-strand | 58 | 1 | 8 |
| β-strand | 75-78 | 4 | 15 |
| β-strand | 84-86 | 3 | 15 |
| α-helix | 87-95 | 9 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Ubiquitin carboxyl-terminal hydrolase 8 | A, E | protein | 476 | Saccharomyces cerevisiae | P50102 (AlphaFold model) |
| Protein SUS1 | B, F | protein | 96 | Saccharomyces cerevisiae | Q6WNK7 (AlphaFold model) |
| SAGA-associated factor 11 | C, G | protein | 72 | Saccharomyces cerevisiae | Q03067 (AlphaFold model) |
| SAGA-associated factor 73 | D, H | protein | 96 | Saccharomyces cerevisiae | P53165 (AlphaFold model) |
Sequence of entity 1 (A, E), FASTA
>4FIP_1 Ubiquitin carboxyl-terminal hydrolase 8 (chains A, E)
GAAAAMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSG
ATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILA
KYWDDVCTKTMVPSMERRDGLSGLINMGNTCFMSSILQCLIHNPYFIRHSMSQIHSNNCK
VRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQ
QDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNN
SKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLP
SVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIG
IVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Sequence of entity 2 (B, F), FASTA
>4FIP_2 Protein SUS1 (chains B, F)
MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQ
ILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Sequence of entity 3 (C, G), FASTA
>4FIP_3 SAGA-associated factor 11 (chains C, G)
MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDING
LQKQQESSQYIH
Sequence of entity 4 (D, H), FASTA
>4FIP_4 SAGA-associated factor 73 (chains D, H)
MRSGDAEIKGIKPKVIEEYSLSQGSGPSNDSWKSLMSSAKDTPLQYDHMNRESLKKYFNP
NAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLEN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 14 |
Primary citation
A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity. Samara, N.L., Ringel, A.E., Wolberger, C. Structure (2012) 20:1414-1424. DOI 10.1016/j.str.2012.05.015 · PubMed
Other PDB entries of the same protein (UniProt P50102 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3MHS 1.89 Å, Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module bound to ubiquitin aldehyde
- 4FK5 2.03 Å, Structure of the SAGA Ubp8(S144N)/Sgf11/Sus1/Sgf73 DUB module
- 6AQR 2.1 Å, SAGA DUB module Ubp8(C146A)/Sgf11/Sus1/Sgf73 bound to monoubiquitin
- 4WA6 2.36 Å, Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
- 3MHH 2.45 Å, Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module
- 3M99 2.7 Å, Structure of the Ubp8-Sgf11-Sgf73-Sus1 SAGA DUB module
- 4FJC 2.83 Å, Structure of the SAGA Ubp8/Sgf11(1-72, Delta-ZnF)/Sus1/Sgf73 DUB module
- 6T9L 3.6 Å, SAGA DUB module bound to a ubiqitinated nucleosome
- 4ZUX 3.82 Å, SAGA DUB module Ubp8/Sgf11/Sus1/Sgf73 bound to ubiqitinated nucleosome
Browse structure collections
About this viewer
MolViewer shows 4FIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.