4FU6: PSIP1 PWWP domain

Crystal structure of the PSIP1 PWWP domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Aug 2012.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 808
Mol. weight: 17.9 kDa
Released: 29 Aug 2012

Explore 4FU6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FU6 contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	10-13	4	1
β-strand	21-25	5	1
α-helix	26-28	3
β-strand	40-44	5	1
β-strand	50-53	4	1
α-helix	55-57	3
β-strand	58-60	3	1
α-helix	61-68	8
α-helix	77-86	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PC4 and SFRS1-interacting protein	A	protein	153	Homo sapiens	O75475 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4FU6_1 PC4 and SFRS1-interacting protein (chains A)
MHHHHHHSSGRENLYFQGMTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPI
FFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQS
NASSDVEVEEKETSVSKEDTDHEEKASNEDVTK

Primary citation

Structure and function of the nucleosome-binding PWWP domain. Qin, S., Min, J. Trends Biochem Sci (2014) 39:536-547. DOI 10.1016/j.tibs.2014.09.001 · PubMed

Other PDB entries of the same protein (UniProt O75475 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TRJ 1.3 Å, LEDGF/p75 IBD dimer
9S81 1.63 Å, Crystal structure of the LEDGF PWWP domain
5N88 1.7 Å, Crystal structure of antibody bound to viral protein
2B4J 2.02 Å, Structural basis for the recognition between HIV-1 integrase and LEDGF/p75
5OYM 2.05 Å, HIV Integrase Binding Domain of Lens Epithelium-Derived Growth Factor
9S83 2.1 Å, Crystal structure of de novo designed binder JUBO4 and the LEDGF PWWP domain
3HPH 2.64 Å, Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
8PEO 2.69 Å, H3K36me2 nucleosome-LEDGF/p75 PWWP domain complex
9S28 2.8 Å, MVV STC intasome in complex with LEDGF
9S29 2.8 Å, MVV CSC intasome in complex with LEDGF
3U88 3.0 Å, Crystal structure of human menin in complex with MLL1 and LEDGF
7OUF 3.0 Å, Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor XZ450

Browse structure collections

About this viewer

MolViewer shows 4FU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.