Crystal structure of HCR/D-Sa-GBL1/C. Determined by X-ray diffraction at 2.7 Å resolution. Released 24 Oct 2012.
Explore 4FVV in 3D Show helices and sheets RCSB PDB PDBe
4FVV contains 19 α-helices and 72 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 865-867 | 3 | |
| β-strand | 868-875 | 8 | 1 |
| β-strand | 878-881 | 4 | 1 |
| β-strand | 888-892 | 5 | 2 |
| β-strand | 894 | 1 | 3 |
| β-strand | 896-897 | 2 | 1 |
| β-strand | 905-908 | 4 | 1 |
| β-strand | 914 | 1 | 3 |
| β-strand | 916-920 | 5 | 2 |
| α-helix | 926-931 | 6 | |
| β-strand | 933-943 | 11 | 1 |
| α-helix | 949-951 | 3 | |
| β-strand | 952-958 | 7 | 2 |
| β-strand | 963-968 | 6 | 2 |
| β-strand | 972-978 | 7 | 2 |
| β-strand | 984-990 | 7 | 2 |
| α-helix | 993-995 | 3 | |
| β-strand | 1004-1011 | 8 | 1 |
| β-strand | 1015-1020 | 6 | 1 |
| β-strand | 1023-1029 | 7 | 1 |
| β-strand | 1041-1048 | 8 | 2 |
| β-strand | 1063-1072 | 10 | 1 |
| α-helix | 1078-1087 | 10 | |
| β-strand | 1093 | 1 | 4 |
| β-strand | 1095 | 1 | 5 |
| β-strand | 1101 | 1 | 5 |
| α-helix | 1102 | 1 | |
| β-strand | 1103 | 1 | 6 |
| β-strand | 1107-1112 | 6 | 7 |
| α-helix | 1113-1115 | 3 | |
| β-strand | 1118-1123 | 6 | 7 |
| β-strand | 1126-1131 | 6 | 7 |
| β-strand | 1144-1150 | 7 | 7 |
| β-strand | 1157 | 1 | 6 |
| β-strand | 1159 | 1 | 4 |
| β-strand | 1163-1169 | 7 | 7 |
| β-strand | 1174-1179 | 6 | 7 |
| β-strand | 1190-1196 | 7 | 7 |
| α-helix | 1200-1206 | 7 | |
| β-strand | 1209-1215 | 7 | 7 |
| β-strand | 1220-1227 | 8 | 7 |
| β-strand | 1234-1245 | 12 | 7 |
| β-strand | 1254-1263 | 10 | 7 |
| α-helix | 1273-1275 | 3 | |
| β-strand | 1277-1281 | 5 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 865-867 | 3 | |
| β-strand | 868-874 | 7 | 8 |
| β-strand | 879-881 | 3 | 8 |
| β-strand | 888-892 | 5 | 9 |
| β-strand | 894 | 1 | 10 |
| β-strand | 896-897 | 2 | 8 |
| β-strand | 905-908 | 4 | 8 |
| β-strand | 914 | 1 | 10 |
| β-strand | 916-920 | 5 | 9 |
| α-helix | 925-931 | 7 | |
| β-strand | 933-943 | 11 | 8 |
| α-helix | 949-951 | 3 | |
| β-strand | 952-958 | 7 | 9 |
| β-strand | 963-969 | 7 | 9 |
| β-strand | 972-978 | 7 | 9 |
| β-strand | 985-990 | 6 | 9 |
| β-strand | 1004-1011 | 8 | 8 |
| β-strand | 1015-1020 | 6 | 8 |
| β-strand | 1023-1029 | 7 | 8 |
| β-strand | 1041-1048 | 8 | 9 |
| α-helix | 1049 | 1 | |
| β-strand | 1063-1072 | 10 | 8 |
| α-helix | 1078-1087 | 10 | |
| β-strand | 1093 | 1 | 11 |
| β-strand | 1095 | 1 | 12 |
| β-strand | 1101 | 1 | 12 |
| α-helix | 1102 | 1 | |
| β-strand | 1103 | 1 | 13 |
| β-strand | 1107-1112 | 6 | 14 |
| α-helix | 1113-1115 | 3 | |
| β-strand | 1118-1123 | 6 | 15 |
| β-strand | 1126-1131 | 6 | 15 |
| β-strand | 1144-1150 | 7 | 14 |
| β-strand | 1157 | 1 | 13 |
| β-strand | 1159 | 1 | 11 |
| β-strand | 1163-1169 | 7 | 14 |
| β-strand | 1174-1179 | 6 | 14 |
| β-strand | 1190-1196 | 7 | 14 |
| α-helix | 1200-1202 | 3 | |
| α-helix | 1203-1207 | 5 | |
| β-strand | 1209-1215 | 7 | 14 |
| β-strand | 1220-1227 | 8 | 14 |
| β-strand | 1234-1245 | 12 | 14 |
| β-strand | 1254-1263 | 10 | 14 |
| α-helix | 1273-1275 | 3 | |
| β-strand | 1277-1281 | 5 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neurotoxin | A, B | protein | 423 | Clostridium botulinum | Q9LBR1 |
>4FVV_1 Neurotoxin (chains A, B) NSINDSKILSLQNKKNTLMDTSGYNAEVRVEGNVQLNPIFPFDFKLGSSGDDRGKVIVTQ NENIVYNAMYESFSISFWIRINKWVSNLPGYTIIDSVKNNSGWSIGIISNFLVFTLKQNE NSEQDINFSYDISKNAAGYNKWFFVTITTNMMGNMMIYINGKLIDTIKVKELTGINFSKT ITFQMNKIPNTGLITSDSDNINMWIRDFYIFAKELDDKDINILFNSLQYTNVVKDYWGND LRYDKEYYMINVNYMNRYMSKKGNGIVFNTRKNNNDFNEGYKIIIKRIRGNTNDTRVRGE NVLYFNTTIDNKQYSLGMYKPSRNLGTDLVPLGALDQPMDEIRKYGSFIIQPCNTFDYYA SQLFLSSNATTNRLGILSIGSYSFRLGGDWYRHEYLIPVIKIEHYASLLESTSTHWVFVP ASE
| ID | Name | Formula | Copies |
|---|---|---|---|
| SIA | N-acetyl-alpha-neuraminic acid | C11 H19 N O9 | 1 |
Water and common crystallization additives (GOL, SO4) are not listed.
Botulinum neurotoxin serotype C associates with dual ganglioside receptors to facilitate cell entry. Karalewitz, A.P., Fu, Z., Baldwin, M.R. et al. J Biol Chem (2012) 287:40806-40816. DOI 10.1074/jbc.M112.404244 · PubMed
Other PDB entries of the same protein (UniProt Q9LBR1), best resolution first:
MolViewer shows 4FVV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.