4FWF: Lysine-specific histone demethylase 1B

Complex structure of LSD2/AOF1/KDM1b with H3K4 mimic. Determined by X-ray diffraction at 2.7 Å resolution. Released 16 Jan 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,826
Mol. weight: 92.52 kDa
Ligands: ZN, FAD
Released: 16 Jan 2013

Explore 4FWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FWF contains 46 α-helices and 37 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 45 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	65	1	1
β-strand	83-86	4	1
β-strand	89-91	3	1
α-helix	93-100	8
α-helix	107-120	14
α-helix	124-125	2
α-helix	127-130	4
α-helix	131-135	5
α-helix	137-138	2
β-strand	139-141	3	2
β-strand	150-152	3	2
α-helix	153-154	2
α-helix	161-165	5
α-helix	188-189	2
α-helix	192-195	4
β-strand	211	1	3
α-helix	217-220	4
α-helix	225-228	4
β-strand	230	1	3
β-strand	272	1	4
α-helix	273-274	2
β-strand	284	1	4
α-helix	291-296	6
α-helix	298-300	3
α-helix	305-320	16
α-helix	328-331	4
α-helix	332-334	3
α-helix	341-358	18
α-helix	378-380	3
β-strand	384-388	5	5
α-helix	392-404	13
β-strand	407-411	5	5
β-strand	423-424	2	6
β-strand	432-433	2	6
β-strand	438-440	3	7
α-helix	446-453	8
β-strand	458-460	3	7
α-helix	461-462	2
β-strand	467-469	3	8
α-helix	473	1
β-strand	474	1	8
α-helix	475-476	2
α-helix	477-497	21
α-helix	503-505	3
β-strand	508	1	9
α-helix	509-524	16
α-helix	530-547	18
β-strand	554	1	10
β-strand	555	1	9
α-helix	561-564	4
α-helix	566-567	2
β-strand	572-575	4	7
α-helix	579-587	9
β-strand	592-593	2	5
β-strand	598-602	5	11
β-strand	608-612	5	11
β-strand	617-620	4	11
β-strand	622-625	4	5
α-helix	629-634	6
β-strand	638-640	3	11
α-helix	642-644	3
α-helix	645-653	9
β-strand	654-657	4	12
β-strand	660-665	6	8
α-helix	672-675	4
β-strand	680-684	5	8
α-helix	688-690	3
β-strand	693-699	7	8
β-strand	708-713	6	8
α-helix	716-719	4
α-helix	726-740	15
α-helix	747-749	3
β-strand	751-754	4	8
α-helix	757-759	3
β-strand	767-770	4	12
β-strand	771	1	10
α-helix	777-783	7
α-helix	784-785	2
β-strand	786	1	5
β-strand	790-792	3	5
α-helix	795-797	3
α-helix	805-820	16

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lysine-specific histone demethylase 1B	A	protein	796	Homo sapiens	Q8NB78 (AlphaFold model)
Histone H3.1	E	protein	20	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4FWF_1 Lysine-specific histone demethylase 1B (chains A)
GHMAKKKATETTDEDEDGGSEKKYRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLS
CGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWVQCTKPE
CRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPEDLRVLEVSNHWWYSMLI
LPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMN
RYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDPTMYLALRNLILALWYTNCKEAL
TPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVGADQYLLPKDYHNKSVI
IIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCINNP
VALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLDVVSEWRKDKTQLQD
VPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNLEYACGSNLHQVSARSWDHNEFFA
QFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLVT
VPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPP
SASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEV
PDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVT
GAYLSGVREASKIAAF

Sequence of entity 2 (E), FASTA

>4FWF_2 Histone H3.1 (chains E)
ARTMQTARKSTGGKAPRKQL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	1

Primary citation

Structure-function analysis reveals a novel mechanism for regulation of histone demethylase LSD2/AOF1/KDM1b. Zhang, Q., Qi, S., Xu, M. et al. Cell Res (2013) 23:225-241. DOI 10.1038/cr.2012.177 · PubMed

Other PDB entries of the same protein (UniProt Q8NB78 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HSU 1.99 Å, Crystal structure of LSD2-NPAC with H3(1-26)in space group P21
4GUT 2.0 Å, Crystal structure of LSD2-NPAC
7XE2 2.05 Å, Crystal structure of LSD2 in complex with trans-4-Br-PCPA
7XE1 2.07 Å, Crystal structure of LSD2 in complex with cis-4-Br-PCPA
4FWE 2.13 Å, Native structure of LSD2 /AOF1/KDM1b in spacegroup of C2221 at 2.13A
4GUS 2.23 Å, Crystal structure of LSD2-NPAC with H3 in space group P3221
4GUU 2.3 Å, Crystal structure of LSD2-NPAC with tranylcypromine
4GUR 2.51 Å, Crystal structure of LSD2-NPAC with H3 in space group P21
7XE3 2.82 Å, Crystal structure of LSD2 in complex with cis-4-Br-2,5-F2-PCPA (S1024)
4FWJ 2.9 Å, Native structure of LSD2/AOF1/KDM1b in spacegroup of I222 at 2.9A
4GU1 2.94 Å, Crystal structure of LSD2
4GU0 3.1 Å, Crystal structure of LSD2 with H3

Browse structure collections

About this viewer

MolViewer shows 4FWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.