4FWT: PDB entry 4FWT

Complex structure of viral RNA polymerase form III. Determined by X-ray diffraction at 3.2 Å resolution. Released 8 Aug 2012.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Escherichia coli O157:H7, Escherichia phage Qbeta
Chains: 3
Atoms: 9,582
Mol. weight: 147.1 kDa
Ligands: CA, GTP
Released: 8 Aug 2012

Explore 4FWT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FWT contains 53 α-helices and 65 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 53 helices, 65 β-strands

Element	Residues	Length	Sheet
α-helix	9-13	5
α-helix	21-24	4
α-helix	35-43	9
α-helix	46-49	4
β-strand	64-67	4	1
β-strand	70-77	8	1
α-helix	81-84	4
α-helix	89-102	14
α-helix	108-114	7
α-helix	116-123	8
β-strand	131-139	9	1
β-strand	142-148	7	2
β-strand	152-158	7	2
α-helix	166-176	11
α-helix	191-203	13
α-helix	209-227	19
β-strand	233	1	3
β-strand	241	1	3
α-helix	242-248	7
β-strand	255-259	5	2
α-helix	272-284	13
β-strand	296-303	8	4
α-helix	309-322	14
β-strand	351-355	5	4
β-strand	360-365	6	4
α-helix	369-376	8
β-strand	385-391	7	4
α-helix	400-407	8
β-strand	415-420	6	4
α-helix	428-443	16
α-helix	449-451	3
β-strand	454-456	3	4
α-helix	460-464	5
α-helix	467-480	14
α-helix	485-487	3
α-helix	490-492	3
β-strand	496	1	5
β-strand	498	1	6
β-strand	501-505	5	7
β-strand	509-515	7	7
β-strand	518	1	5
β-strand	521-522	2	8
β-strand	526-529	4	9
β-strand	530	1	6
β-strand	536-539	4	9
β-strand	540-544	5	7
β-strand	552-553	2	8
β-strand	558-563	6	7
α-helix	568-570	3
β-strand	576	1	6
β-strand	585-595	11	10
β-strand	607	1	11
β-strand	614	1	10
β-strand	623-627	5	10
α-helix	628-629	2
β-strand	635	1	11
β-strand	639-652	14	10
β-strand	658-663	6	10
β-strand	666-676	11	10
α-helix	703-713	11
α-helix	723-732	10
α-helix	733-735	3
α-helix	737-740	4
α-helix	745-747	3
α-helix	757-769	13
α-helix	770-772	3
α-helix	784-803	20
β-strand	812	1	12
β-strand	814	1	12
α-helix	817-833	17
α-helix	839-843	5
α-helix	858-860	3
α-helix	864-867	4
β-strand	871-873	3	13
α-helix	878-887	10
β-strand	894-897	4	13
β-strand	900-903	4	14
β-strand	907	1	15
β-strand	913	1	15
β-strand	917-918	2	14
α-helix	923-936	14
α-helix	937-941	5
α-helix	949-951	3
α-helix	954-961	8
β-strand	964-966	3	16
β-strand	969	1	17
α-helix	973-975	3
β-strand	977	1	18
α-helix	978-984	7
α-helix	987-996	10
β-strand	1000-1002	3	14
β-strand	1008-1010	3	14
β-strand	1013	1	18
β-strand	1017	1	19
β-strand	1019	1	19
α-helix	1022-1039	18
α-helix	1045-1047	3
β-strand	1049-1051	3	16
β-strand	1054-1058	5	16
α-helix	1062-1072	11
β-strand	1076	1	17
β-strand	1082	1	16
β-strand	1087-1090	4	20
β-strand	1093-1096	4	20
β-strand	1099-1100	2	20
α-helix	1109-1110	2
α-helix	1113-1126	14
β-strand	1128	1	21
β-strand	1133	1	21
α-helix	1135-1145	11
α-helix	1150-1153	4
β-strand	1156-1157	2	22
β-strand	1166-1167	2	22
β-strand	1177-1179	3	23
β-strand	1182-1194	13	23
α-helix	1199-1214	16
α-helix	1242-1245	4
β-strand	1248-1260	13	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor Ts, Elongation factor Tu, LINKER, Q beta replicase	A	protein	1289	Escherichia coli O157:H7, Escherichia phage Qbeta	P0A6N3 (AlphaFold model), P0A6P3 (AlphaFold model), P14647
RNA (5'-r(ccpcpupapcpcpc)-3')	G	RNA	8
RNA (5'-r(gpgpgpupapgpgpg)-3')	T	RNA	8

Sequence of entity 1 (A), FASTA

>4FWT_1 Elongation factor Ts, Elongation factor Tu, LINKER, Q beta replicase (chains A)
MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADG
VIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERV
ALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEF
IKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSK
TVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQSHMSKEKFERTKPHVNVG
TIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARGITINTSHVEYDTPTRH
YAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLN
KCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFL
DSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTC
TGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILSKDE
GGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFA
IREGGRTVGAGVVAKVLSGASGAAGGGGSGGGGSMSKTASSRNSLSAQLRRAANTRIEVE
GNLALSIANDLLLAYGQSPFNSEAECISFSPRFDGTPDDFRINYLKAEIMSKYDDFSLGI
DTEAVAWEKFLAAEAECALTNARLYRPDYSEDFNFSLGESCIHMARRKIAKLIGDVPSVE
GMLRHCRFSGGATTTNNRSYGHPSFKFALPQACTPRALKYVLALRASTHFDIRISDISPF
NKAVTVPKNSKTDRCIAIEPGWNMFFQLGIGGILRDRLRCWGIDLNDQTINQRRAHEGSV
TNNLATVDLSAASDSISLALCELLLPPGWFEVLMDLRSPKGRLPDGSVVTYEKISSMGNG
YTFELESLIFASLARSVCEILDLDSSEVTVYGDDIILPSCAVPALREVFKYVGFTTNTKK
TFSEGPFRESCGKHYYSGVDVTPFYIRHRIVSPADLILVLNNLYRWATIDGVWDPRAHSV
YLKYRKLLPKQLQRNTIPDGYGDGALVGSVLINPFAKNRGWIRYVPVITDHTRDRERAEL
GSYLYDLFSRCLSESNDGLPLRGPSGCDSADLFAIDQLICRSNPTKISRSTGKFDIQYIA
CSSRVLAPYGVFQGTKVASLHEAHHHHHH

Sequence of entity 2 (G), FASTA

>4FWT_2 RNA (5'-R(*C*CP*CP*UP*AP*CP*CP*C)-3') (chains G)
CCCUACCC

Sequence of entity 3 (T), FASTA

>4FWT_3 RNA (5'-R(*GP*GP*GP*UP*AP*GP*GP*G)-3') (chains T)
GGGUAGGG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1

Primary citation

Mechanism for template-independent terminal adenylation activity of Q beta replicase. Takeshita, D., Yamashita, S., Tomita, K. Structure (2012) 20:1661-1669. DOI 10.1016/j.str.2012.07.004 · PubMed

Other PDB entries of the same protein (UniProt P0A6N3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AVX 2.41 Å, Structure of viral RNA polymerase complex 5
3AVW 2.6 Å, Structure of viral RNA polymerase complex 4
3VNV 2.6 Å, Complex structure of viral RNA polymerase II
3AVT 2.61 Å, Structure of viral RNA polymerase complex 1
3AVY 2.62 Å, Structure of viral RNA polymerase complex 6
3AGP 2.8 Å, Structure of viral polymerase form I
3AVU 2.91 Å, Structure of viral RNA polymerase complex 2
3AVV 3.12 Å, Structure of viral RNA polymerase complex 3
3VNU 3.2 Å, Complex structure of viral RNA polymerase I
3AGQ 3.22 Å, Structure of viral polymerase form II

Browse structure collections

About this viewer

MolViewer shows 4FWT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.