4GGN: Malaria invasion machinery protein complex
Malaria invasion machinery protein complex. Determined by X-ray diffraction at 2.29 Å resolution. Released 3 Jul 2013.
- Method
- X-ray diffraction
- Resolution
- 2.29 Å
- Organisms
- Plasmodium knowlesi, Plasmodium yoelii yoelii
- Chains
- 6
- Atoms
- 3,611
- Mol. weight
- 49.4 kDa
- Released
- 3 Jul 2013
Explore 4GGN in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4GGN contains 33 α-helices and 14 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 81-85 | 5 | |
| β-strand | 91-92 | 2 | 1 |
| α-helix | 93-102 | 10 | |
| α-helix | 109-119 | 11 | |
| β-strand | 122-123 | 2 | 1 |
| α-helix | 125-134 | 10 | |
| α-helix | 142-145 | 4 | |
| α-helix | 147-152 | 6 | |
| β-strand | 159-161 | 3 | 2 |
| α-helix | 162-171 | 10 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-188 | 11 | |
| β-strand | 193-195 | 3 | 2 |
| α-helix | 196-203 | 8 | |
Chain B: 9 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 87 | 1 | 3 |
| β-strand | 90-92 | 3 | 3 |
| α-helix | 93-102 | 10 | |
| α-helix | 109-119 | 11 | |
| β-strand | 122-124 | 3 | 3 |
| α-helix | 125-134 | 10 | |
| α-helix | 142-145 | 4 | |
| α-helix | 147-152 | 6 | |
| β-strand | 159-161 | 3 | 4 |
| α-helix | 162-171 | 10 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-188 | 11 | |
| β-strand | 193-195 | 3 | 4 |
| α-helix | 196-203 | 8 | |
Chain C: 11 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 81-85 | 5 | |
| β-strand | 87 | 1 | 5 |
| β-strand | 90-92 | 3 | 5 |
| α-helix | 93-102 | 10 | |
| α-helix | 109-119 | 11 | |
| β-strand | 122-124 | 3 | 5 |
| α-helix | 125-134 | 10 | |
| α-helix | 142-145 | 4 | |
| α-helix | 147-152 | 6 | |
| α-helix | 154-156 | 3 | |
| β-strand | 159-161 | 3 | 6 |
| α-helix | 162-171 | 10 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-188 | 11 | |
| β-strand | 193-195 | 3 | 6 |
| α-helix | 196-203 | 8 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 804-815 | 12 | |
Chains E and F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 804-814 | 11 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Myosin A tail domain interacting protein MTIP | A, B, C | protein | 127 | Plasmodium knowlesi | A0A384KCF1 (AlphaFold model) |
| Myosin-A | D, E, F | protein | 15 | Plasmodium yoelii yoelii | Q7RQ71 (AlphaFold model) |
Sequence of entity 1 (A, B, C), FASTA
>4GGN_1 Myosin A tail domain interacting protein MTIP (chains A, B, C)
KDMFNTKSSNGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHD
RDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKL
FCEDILS
Sequence of entity 2 (D, E, F), FASTA
>4GGN_2 Myosin-A (chains D, E, F)
SLMRVQAHIRKRMVA
Primary citation
The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody. Khamrui, S., Turley, S., Pardon, E. et al. Mol Biochem Parasitol (2013) 190:87-91. DOI 10.1016/j.molbiopara.2013.06.003 · PubMed
Browse structure collections
About this viewer
MolViewer shows 4GGN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.