4GIZ: Full-length human papillomavirus oncoprotein E6

Crystal structure of full-length human papillomavirus oncoprotein E6 in complex with LXXLL peptide of ubiquitin ligase E6AP at 2.55 A resolution. Determined by X-ray diffraction at 2.55 Å resolution. Released 23 Jan 2013.

Method: X-ray diffraction
Resolution: 2.55 Å
Organisms: Escherichia coli, HOMO SAPIENS, Human papillomavirus type 16
Chains: 4
Atoms: 9,036
Mol. weight: 119.86 kDa
Ligands: ZN
Released: 23 Jan 2013

Explore 4GIZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GIZ contains 80 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 26 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	3-4	2
β-strand	7-11	5	1
α-helix	14-16	3
α-helix	20-32	13
β-strand	35-39	5	1
α-helix	44-52	9
β-strand	60-64	5	1
α-helix	65-67	3
α-helix	68-73	6
β-strand	77	1	2
α-helix	78-80	3
α-helix	84-87	4
β-strand	90	1	3
α-helix	92-97	6
β-strand	99-100	2	4
β-strand	103-104	2	4
β-strand	107-112	6	1
β-strand	115-119	5	5
β-strand	129	1	6
α-helix	130-132	3
α-helix	133-141	9
β-strand	146-148	3	5
α-helix	155-164	10
β-strand	168-173	6	7
β-strand	176-183	8	7
α-helix	187-201	15
α-helix	211-219	9
β-strand	223-228	6	5
α-helix	230-232	3
α-helix	233-239	7
β-strand	243-246	4	5
α-helix	247-249	3
β-strand	250-251	2	6
β-strand	254-255	2	6
α-helix	256	1
β-strand	259-260	2	8
β-strand	261-267	7	1
β-strand	268	1	2
α-helix	274-280	7
α-helix	281-285	5
α-helix	288-297	10
β-strand	302-303	2	1
β-strand	305	1	3
α-helix	306-312	7
α-helix	316-326	11
β-strand	329-330	2	8
α-helix	331-332	2
α-helix	337-352	16
α-helix	358-379	22

Chain C: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	17
α-helix	12-19	8
β-strand	29	1	18
β-strand	30	1	19
α-helix	35	1
β-strand	36	1	18
α-helix	37-38	2
α-helix	39-47	9
α-helix	50	1
β-strand	51	1	17
α-helix	52	1
β-strand	53-55	3	20
β-strand	58-60	3	20
β-strand	61	1	19
α-helix	64-78	15
β-strand	79-83	5	21
α-helix	85-92	8
α-helix	96-98	3
β-strand	102-103	2	21
α-helix	108	1
β-strand	109	1	21
α-helix	110-111	2
α-helix	112-120	9
α-helix	123-124	2
β-strand	125-128	4	21
β-strand	131-134	4	21
α-helix	137-141	5

Chain D: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	22
α-helix	12-19	8
β-strand	29	1	23
β-strand	30	1	24
α-helix	35	1
β-strand	36	1	23
α-helix	37-38	2
α-helix	39-47	9
α-helix	50	1
β-strand	51	1	22
α-helix	52	1
β-strand	53-55	3	25
β-strand	58-60	3	25
β-strand	61	1	24
α-helix	64-78	15
β-strand	79-83	5	26
α-helix	85-92	8
α-helix	96-98	3
β-strand	101-103	3	26
α-helix	108	1
β-strand	109	1	26
α-helix	110-111	2
α-helix	112-120	9
α-helix	123-124	2
β-strand	125-128	4	26
β-strand	131-134	4	26
α-helix	137-140	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein, UBIQUITIN LIGASE EA6P: chimeric protein	A, B	protein	382	Escherichia coli, HOMO SAPIENS	P0AEX9 (AlphaFold model), Q05086 (AlphaFold model)
Protein E6	C, D	protein	142	Human papillomavirus type 16	P03126 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4GIZ_1 Maltose-binding periplasmic protein, UBIQUITIN LIGASE EA6P: chimeric protein (chains A, B)
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDII
FWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD
LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKD
VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG
AVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAA
LAAAQTNAAAELTLQELLGEER

Sequence of entity 2 (C, D), FASTA

>4GIZ_2 Protein E6 (chains C, D)
FQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDLCIVYRDGNPYA
VCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLLIRCINCQKPLSPEEKQRHLDK
KQRFHNIRGRWTGRCMSCSRSS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Zanier, K., Charbonnier, S., Sidi, A.O. et al. Science (2013) 339:694-698. DOI 10.1126/science.1229934 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 4GIZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.