Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-7. Determined by X-ray diffraction at 1.47 Å resolution. Released 2 Jan 2013.
Explore 4GNE in 3D Show helices and sheets RCSB PDB PDBe
4GNE contains 5 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1332-1335 | 4 | 1 |
| α-helix | 1336 | 1 | |
| β-strand | 1344-1345 | 2 | 1 |
| α-helix | 1348-1350 | 3 | |
| α-helix | 1355-1356 | 2 | |
| α-helix | 1363-1365 | 3 | |
| β-strand | 1366 | 1 | 2 |
| β-strand | 1373 | 1 | 2 |
| α-helix | 1374 | 1 | |
| β-strand | 1376-1377 | 2 | 3 |
| β-strand | 1384-1385 | 2 | 3 |
| β-strand | 1395-1396 | 2 | 4 |
| β-strand | 1403-1404 | 2 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase NSD3 | A | protein | 107 | Homo sapiens | Q9BZ95 (AlphaFold model) |
| Histone H3.3 | B | protein | 7 | Homo sapiens | P84243 (AlphaFold model) |
>4GNE_1 Histone-lysine N-methyltransferase NSD3 (chains A) SNARKIKTEPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQ CDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP
>4GNE_2 Histone H3.3 (chains B) ARTKQTA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition. He, C., Li, F., Zhang, J. et al. J Biol Chem (2013) 288:4692-4703. DOI 10.1074/jbc.M112.426148 · PubMed
Other PDB entries of the same protein (UniProt Q9BZ95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4GNE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.