Crystal Structure of JNK3 in Complex with SAB Peptide. Determined by X-ray diffraction at 2.08 Å resolution. Released 21 Nov 2012.
Explore 4H3B in 3D Show helices and sheets RCSB PDB PDBe
4H3B contains 47 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 48-53 | 6 | 1 |
| β-strand | 56-61 | 6 | 1 |
| β-strand | 64-73 | 10 | 2 |
| β-strand | 76-83 | 8 | 2 |
| β-strand | 88-95 | 8 | 2 |
| α-helix | 102-116 | 15 | |
| β-strand | 123 | 1 | 3 |
| β-strand | 126-130 | 5 | 2 |
| β-strand | 143-147 | 5 | 2 |
| β-strand | 151-152 | 2 | 3 |
| α-helix | 153-158 | 6 | |
| α-helix | 163-182 | 20 | |
| α-helix | 192-194 | 3 | |
| β-strand | 195-197 | 3 | 3 |
| β-strand | 203-205 | 3 | 3 |
| α-helix | 216-219 | 4 | |
| α-helix | 227-229 | 3 | |
| α-helix | 232-235 | 4 | |
| α-helix | 244-258 | 15 | |
| α-helix | 268-279 | 12 | |
| α-helix | 281-283 | 3 | |
| α-helix | 284-287 | 4 | |
| α-helix | 292-299 | 8 | |
| α-helix | 302-303 | 2 | |
| α-helix | 309-312 | 4 | |
| α-helix | 315-317 | 3 | |
| α-helix | 326-339 | 14 | |
| α-helix | 344-346 | 3 | |
| α-helix | 348-349 | 2 | |
| α-helix | 350-355 | 6 | |
| α-helix | 357-360 | 4 | |
| α-helix | 365-368 | 4 | |
| α-helix | 378-380 | 3 | |
| α-helix | 387-399 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 342-344 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 48-53 | 6 | 4 |
| β-strand | 56-61 | 6 | 4 |
| β-strand | 64-73 | 10 | 5 |
| β-strand | 76-83 | 8 | 5 |
| β-strand | 88-95 | 8 | 5 |
| α-helix | 102-116 | 15 | |
| β-strand | 123 | 1 | 6 |
| β-strand | 126-130 | 5 | 5 |
| β-strand | 143-147 | 5 | 5 |
| β-strand | 151-152 | 2 | 6 |
| α-helix | 153-157 | 5 | |
| α-helix | 163-182 | 20 | |
| α-helix | 192-194 | 3 | |
| β-strand | 195-197 | 3 | 6 |
| β-strand | 203-205 | 3 | 6 |
| α-helix | 216-219 | 4 | |
| α-helix | 227-229 | 3 | |
| α-helix | 232-235 | 4 | |
| α-helix | 244-258 | 15 | |
| α-helix | 268-279 | 12 | |
| α-helix | 281-283 | 3 | |
| α-helix | 284-287 | 4 | |
| α-helix | 292-299 | 8 | |
| α-helix | 309-312 | 4 | |
| α-helix | 315-317 | 3 | |
| α-helix | 329-339 | 11 | |
| α-helix | 344-346 | 3 | |
| α-helix | 348-349 | 2 | |
| α-helix | 350-355 | 6 | |
| α-helix | 357-360 | 4 | |
| α-helix | 365-368 | 4 | |
| α-helix | 370-372 | 3 | |
| α-helix | 378-380 | 3 | |
| α-helix | 387-399 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitogen-activated protein kinase 10 | A, C | protein | 356 | Homo sapiens | P53779 (AlphaFold model) |
| SH3 domain-binding protein 5 | B, D | protein | 10 | Homo sapiens | O60239 (AlphaFold model) |
>4H3B_1 Mitogen-activated protein kinase 10 (chains A, C) DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTH AKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHE RMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYV VTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCP EFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDP AKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMN
>4H3B_2 SH3 domain-binding protein 5 (chains B, D) VVRPGSLDLP
Structural Mechanisms of Allostery and Autoinhibition in JNK Family Kinases. Laughlin, J.D., Nwachukwu, J.C., Figuera-Losada, M. et al. Structure (2012) 20:2174-2184. DOI 10.1016/j.str.2012.09.021 · PubMed
Other PDB entries of the same protein (UniProt P53779 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4H3B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.