4HJK: U7Ub7 Disulfide variant

U7Ub7 Disulfide variant. Determined by X-ray diffraction at 1.78 Å resolution. Released 21 Nov 2012.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 1
Atoms: 702
Mol. weight: 8.81 kDa
Ligands: PO4
Released: 21 Nov 2012

Explore 4HJK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HJK contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-8	8	1
β-strand	11-17	7	1
β-strand	22	1	2
α-helix	23-34	12
α-helix	42-43	2
β-strand	44-45	2	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	2
α-helix	57-59	3
β-strand	66-73	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin	A	protein	77	Homo sapiens	P62987 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HJK_1 Ubiquitin (chains A)
AMQIFVKCLTGKTNTLEVEPSDTIENVKAKIQDKIGYPPDQQRLIFAGKQLEDGRTLSDY
NIQKESTLHCVRRLRGG

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Potent and selective inhibitors of USP7/HAUSP activity by protein conformational stabilization. Zhang, Y., Zhou, L., Rouge, L. et al. To be published.

Other PDB entries of the same protein (UniProt P62987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GOD 1.15 Å, Lys27-linked di-ubiquitin
5GOB 1.15 Å, Lys6-linked di-ubiquitin
4PIH 1.5 Å, X-ray crystal structure of the K33S mutant of ubiquitin
4PIJ 1.5 Å, X-ray crystal structure of the K11S/K63S double mutant of ubiquitin
5GOJ 1.55 Å, Lys63-linked di-ubiquitin
5J8P 1.55 Å, Lys27-linked diubiquitin
5GOI 1.59 Å, Lys48-linked di-ubiquitin
8A3D 1.67 Å, Human mature large subunit of the ribosome with eIF6 and homoharringtonine bound
5GOC 1.73 Å, Lys11-linked diubiquitin
29IW 1.77 Å, Human monosomes with bound toxin NT-2, focus on 60S subunit. Cells treated with NT-2.
8QYX 1.78 Å, Human 60S ribosomal subunit
5GO7 1.8 Å, Linear tri-ubiquitin

Browse structure collections

About this viewer

MolViewer shows 4HJK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.