4HK3: I2 Fab (unbound) from CH65-CH67 Lineage

I2 Fab (unbound) from CH65-CH67 Lineage. Determined by X-ray diffraction at 3.0 Å resolution. Released 21 Nov 2012.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,234
Mol. weight: 48.47 kDa
Released: 21 Nov 2012

Explore 4HK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HK3 contains 14 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain J: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	32-39	8	2
β-strand	46-51	6	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	65	1	1
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-101	10	2
β-strand	115-116	2	2
β-strand	120-124	5	2
α-helix	127-129	3
β-strand	130	1	3
α-helix	131-132	2
β-strand	133-137	5	4
β-strand	148-149	2	5
β-strand	152-158	7	4
β-strand	159	1	3
β-strand	166-167	2	6
β-strand	172	1	6
β-strand	176-178	3	4
α-helix	179-181	3
β-strand	182-183	2	4
β-strand	189-195	7	4
β-strand	197-198	2	5
β-strand	208-213	6	6
α-helix	214-216	3
β-strand	218-223	6	6

Chain N: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	7
β-strand	9-11	3	8
β-strand	18-23	6	7
α-helix	27-29	3
β-strand	33-37	5	8
β-strand	44-47	4	8
β-strand	48	1	9
β-strand	52	1	9
β-strand	61-66	6	7
β-strand	69-74	6	7
α-helix	79-81	3
β-strand	84-91	8	8
β-strand	96-99	4	8
β-strand	103-106	4	8
α-helix	110-112	3
β-strand	113	1	10
α-helix	114-115	2
β-strand	116-120	5	11
α-helix	121-123	3
α-helix	124-128	5
β-strand	133-141	9	11
β-strand	142	1	10
β-strand	147-152	6	12
β-strand	155-156	2	12
β-strand	161-163	3	11
β-strand	167-168	2	11
β-strand	174-181	8	11
α-helix	184-189	6
β-strand	193-199	7	12
β-strand	202-208	7	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
I2 heavy chain	J	protein	237	Homo sapiens
I2 light chain	N	protein	214	Homo sapiens	Q8N355 (AlphaFold model)

Sequence of entity 1 (J), FASTA

>4HK3_1 I2 heavy chain (chains J)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYIHWVRQAPGQGLEWMGWIHPNSGGTNY
AQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGLEPRSVDYYYYGMDVWGQGT
TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKHHHHHH

Sequence of entity 2 (N), FASTA

>4HK3_2 I2 light chain (chains N)
QSVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPER
FSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody. Schmidt, A.G., Xu, H., Khan, A.R. et al. Proc Natl Acad Sci U S A (2013) 110:264-269. DOI 10.1073/pnas.1218256109 · PubMed

Other PDB entries of the same protein (UniProt Q8N355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DD8 2.3 Å, Crystal Structure of SARS-CoV Spike Receptor-Binding Domain Complexed with Neutralizing…
6VPY 2.36 Å, I33M (I3.2 mutant from CH103 Lineage)
4FQQ 2.42 Å, Crystal Structure of Germline Antibody PGT121-GL Fab
4HK0 2.5 Å, UCA Fab (unbound) from CH65-CH67 Lineage
6UDJ 2.5 Å, HIV-1 bNAb 1-18 in complex with BG505 SOSIP.664 and 10-1074
5UGY 2.8 Å, Influenza hemagglutinin in complex with a neutralizing antibody
6DC3 3.5 Å, RSV prefusion F bound to RSD5 Fab
6UDK 3.9 Å, HIV-1 bNAb 1-55 in complex with modified BG505 SOSIP-based immunogen RC1 and 10-1074
6C5V 4.8 Å, An anti-gH/gL antibody that neutralizes dual-tropic infection defines a site of…

Browse structure collections

About this viewer

MolViewer shows 4HK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.