4HL4: Human TBC1D20 RabGAP domain

Crystal structure of the human TBC1D20 RabGAP domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Jan 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,291
Mol. weight: 33.87 kDa
Ligands: BEF
Released: 16 Jan 2013

Explore 4HL4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HL4 contains 21 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	26-40	15
α-helix	47-55	9
α-helix	63-73	11
α-helix	89-92	4
α-helix	96-104	9
α-helix	107-109	3
α-helix	116-136	21
α-helix	146-157	12
α-helix	159-171	13
α-helix	176-178	3
α-helix	187-191	5
α-helix	192-199	8
α-helix	201-207	7
α-helix	215-217	3
α-helix	218-222	5
α-helix	232-244	13
α-helix	249-260	12
α-helix	262-266	5
α-helix	274-280	7
α-helix	282-283	2
α-helix	288-301	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TBC1 domain family member 20	A	protein	292	Homo sapiens	Q96BZ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HL4_1 TBC1 domain family member 20 (chains A)
GHWDGGAEKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKL
LNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLI
LERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLM
PIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYF
AAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPS

Ligands and cofactors

ID	Name	Formula	Copies
BEF	Beryllium trifluoride ion	Be F3	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail. Gavriljuk, K., Gazdag, E.M., Itzen, A. et al. Proc Natl Acad Sci U S A (2012) 109:21348-21353. DOI 10.1073/pnas.1214431110 · PubMed

Other PDB entries of the same protein (UniProt Q96BZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HLQ 3.3 Å, Crystal structure of human rab1b bound to GDP and BEF3 in complex with the GAP domain of…

Browse structure collections

About this viewer

MolViewer shows 4HL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.