Crystal structure of the human TBC1D20 RabGAP domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Jan 2013.
Explore 4HL4 in 3D Show helices and sheets RCSB PDB PDBe
4HL4 contains 21 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-40 | 15 | |
| α-helix | 47-55 | 9 | |
| α-helix | 63-73 | 11 | |
| α-helix | 89-92 | 4 | |
| α-helix | 96-104 | 9 | |
| α-helix | 107-109 | 3 | |
| α-helix | 116-136 | 21 | |
| α-helix | 146-157 | 12 | |
| α-helix | 159-171 | 13 | |
| α-helix | 176-178 | 3 | |
| α-helix | 187-191 | 5 | |
| α-helix | 192-199 | 8 | |
| α-helix | 201-207 | 7 | |
| α-helix | 215-217 | 3 | |
| α-helix | 218-222 | 5 | |
| α-helix | 232-244 | 13 | |
| α-helix | 249-260 | 12 | |
| α-helix | 262-266 | 5 | |
| α-helix | 274-280 | 7 | |
| α-helix | 282-283 | 2 | |
| α-helix | 288-301 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TBC1 domain family member 20 | A | protein | 292 | Homo sapiens | Q96BZ9 (AlphaFold model) |
>4HL4_1 TBC1 domain family member 20 (chains A) GHWDGGAEKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKL LNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLI LERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLM PIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYF AAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPS
| ID | Name | Formula | Copies |
|---|---|---|---|
| BEF | Beryllium trifluoride ion | Be F3 | 1 |
Water and common crystallization additives (ACT) are not listed.
Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail. Gavriljuk, K., Gazdag, E.M., Itzen, A. et al. Proc Natl Acad Sci U S A (2012) 109:21348-21353. DOI 10.1073/pnas.1214431110 · PubMed
Other PDB entries of the same protein (UniProt Q96BZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4HL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.