4HP9: PDB entry 4HP9

Crystal structure of the N-terminal truncated PAS domain from the hERG potassium channel. Determined by X-ray diffraction at 2.12 Å resolution. Released 27 Mar 2013.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,011
Mol. weight: 14.44 kDa
Released: 27 Mar 2013

Explore 4HP9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HP9 contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	15-19	5
β-strand	29-33	5	1
β-strand	40	1	2
β-strand	41-44	4	1
α-helix	46-52	7
α-helix	56-59	4
β-strand	63	1	2
α-helix	67-69	3
α-helix	76-85	10
β-strand	92-99	8	1
β-strand	105-116	12	1
β-strand	122-131	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Potassium voltage-gated channel subfamily H member 2	A	protein	128	Homo sapiens	Q12809 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HP9_1 Potassium voltage-gated channel subfamily H member 2 (chains A)
GSPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCD
FLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFIL
NFEVVMEK

Primary citation

Structural properties of PAS domains from the KCNH potassium channels. Adaixo, R., Harley, C.A., Castro-Rodrigues, A.F. et al. PLoS One (2013) 8:e59265-e59265. DOI 10.1371/journal.pone.0059265 · PubMed

Other PDB entries of the same protein (UniProt Q12809 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HQA 1.96 Å, Crystal structure of PAS domain from the human ERG (hERG) potassium channel
1BYW 2.6 Å, Structure of the N-terminal domain of the human-erg potassium channel
9CHQ 3.0 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 3 mM K+
8ZYQ 3.18 Å, Cryo-EM Structure of pimozide-bound hERG Channel
8ZYP 3.19 Å, Cryo-EM Structure of E-4031-bound hERG Channel
8ZYN 3.27 Å, Cryo-EM Structure of inhibitor-free hERG Channel
8ZYO 3.29 Å, Cryo-EM Structure of astemizole-bound hERG Channel
9CHP 3.3 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 300 mM K+
9CHS 3.4 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 3 mM K+…
8IO4 3.5 Å, Herg1a-herg1b open state
9CHR 3.5 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel (hERG) in 300 mM K+…
5VA1 3.7 Å, Cryo-EM structure of the human ether-a-go-go related K+ channel

Browse structure collections

About this viewer

MolViewer shows 4HP9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.