4HPM: PCGF1 Ub fold (RAWUL)/BCORL1 PUFD Complex

PCGF1 Ub fold (RAWUL)/BCORL1 PUFD Complex. Determined by X-ray diffraction at 1.85 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,487
Mol. weight: 50.58 kDa
Ligands: PO4
Released: 1 May 2013

Explore 4HPM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HPM contains 22 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1596-1601	6	1
α-helix	1604-1607	4
β-strand	1609-1611	3	2
β-strand	1620-1624	5	2
α-helix	1625-1632	8
α-helix	1636-1642	7
α-helix	1647	1
β-strand	1648-1652	5	2
α-helix	1653-1660	8
α-helix	1678-1680	3
β-strand	1686-1691	6	2
α-helix	1694-1699	6
β-strand	1703-1707	5	1

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	168-176	9	1
β-strand	191-195	5	1
β-strand	199	1	3
α-helix	200-211	12
α-helix	215-217	3
β-strand	219-222	4	1
β-strand	225-226	2	1
α-helix	227-228	2
β-strand	232	1	3
α-helix	233-240	8
α-helix	244-245	2
β-strand	248-253	6	1

Chain C: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1596-1601	6	4
α-helix	1604-1607	4
β-strand	1609-1611	3	5
α-helix	1618-1619	2
β-strand	1620-1624	5	5
α-helix	1625-1632	8
α-helix	1636-1642	7
β-strand	1648-1652	5	5
α-helix	1653-1661	9
β-strand	1686-1691	6	5
α-helix	1694-1699	6
β-strand	1703-1707	5	4

Chain D: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	168-175	8	4
β-strand	191-195	5	4
β-strand	199	1	6
α-helix	200-211	12
β-strand	219-222	4	4
β-strand	225-226	2	4
α-helix	227-228	2
β-strand	232	1	6
α-helix	233-240	8
α-helix	245	1
β-strand	248-253	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BCL-6 corepressor-like protein 1	A, C	protein	122	Homo sapiens	Q5H9F3 (AlphaFold model)
Polycomb group RING finger protein 1	B, D	protein	93	Homo sapiens	Q9BSM1 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4HPM_1 BCL-6 corepressor-like protein 1 (chains A, C)
METRDDFMFELSDKPLLPCYNLQVSVSRGPCNWFLFSDVLKRLKLSSRIFQARFPHFEIT
TMPKAEFYRQVASSQLLTPAERPGGLDDRSPPGSSETVELVRYEPDLLRLLGSEVEFQSC
NS

Sequence of entity 2 (B, D), FASTA

>4HPM_2 Polycomb group RING finger protein 1 (chains B, D)
QGTREQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLF
DNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	4

Primary citation

Structure of the Polycomb Group Protein PCGF1 in Complex with BCOR Reveals Basis for Binding Selectivity of PCGF Homologs. Junco, S.E., Wang, R., Gaipa, J.C. et al. Structure (2013) 21:665-671. DOI 10.1016/j.str.2013.02.013 · PubMed

Other PDB entries of the same protein (UniProt Q5H9F3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JH5 2.55 Å, Structural Basis for the Hierarchical Assembly of the Core of PRC1.1

Browse structure collections

About this viewer

MolViewer shows 4HPM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.