4HT6: Dynein light chain 1, cytoplasmic

The Structure of a Yeast Dynein Dyn2-Pac11 Complex and Effect on Single Molecule Dynein Motor Activity. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Sept 2013.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae
Chains: 6
Atoms: 2,617
Mol. weight: 36.45 kDa
Released: 18 Sept 2013

Explore 4HT6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HT6 contains 6 α-helices and 16 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-16	7	1
α-helix	18-34	17
α-helix	38-53	16
β-strand	57-72	16	1
β-strand	75-81	7	1
β-strand	84-90	7	1

Chains B, D and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	76-82	7	1

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-16	7	1
α-helix	18-32	15
α-helix	38-53	16
β-strand	57-72	16	1
β-strand	75-81	7	1
β-strand	84-90	7	1

Chain E: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-16	7	2
α-helix	18-34	17
α-helix	38-53	16
β-strand	57-62	6	2
β-strand	66-72	7	3
β-strand	75-81	7	2
β-strand	84-90	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 1, cytoplasmic	A, C, E	protein	97	Saccharomyces cerevisiae	Q02647 (AlphaFold model)
WD repeat-containing protein PAC11	B, D, F	protein	11	Saccharomyces cerevisiae	P40960 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>4HT6_1 Dynein light chain 1, cytoplasmic (chains A, C, E)
GPLGSMSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGN
TWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA

Sequence of entity 2 (B, D, F), FASTA

>4HT6_2 WD repeat-containing protein PAC11 (chains B, D, F)
ITYDKGIQTDQ

Primary citation

The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. Rao, L., Romes, E.M., Nicholas, M.P. et al. Mol Biol Cell (2013) 24:2362-2377. DOI 10.1091/mbc.E13-03-0166 · PubMed

Other PDB entries of the same protein (UniProt Q02647 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DS1 1.85 Å, The Structure of a Yeast Dyn2-Nup159 Complex and the Molecular Basis for the Dynein…
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZA Integrative structure and functional anatomy of a single spoke of a nuclear pore complex
8ZZB Integrative structure and functional anatomy of three spokes of a nuclear pore complex
8ZZC Integrative structure and functional anatomy of eight spokes of a nuclear pore complex
8ZZK Structure of the S. cerevisiae nuclear pore complex cytoplasmic mRNA export platform,…
9A0F Integrative model of the wild type yeast nuclear pore complex

Browse structure collections

About this viewer

MolViewer shows 4HT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.