4HWB: Ectodomain 3 of the IL-13 receptor alpha 1

Crystal structure of ectodomain 3 of the IL-13 receptor alpha 1 in complex with a human neutralizing monoclonal antibody fragment. Determined by X-ray diffraction at 2.61 Å resolution. Released 27 Feb 2013.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,278
Mol. weight: 64.41 kDa
Ligands: NHE
Released: 27 Feb 2013

Explore 4HWB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HWB contains 19 α-helices and 51 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	202-205	4
β-strand	206-213	8	1
β-strand	216-222	7	1
α-helix	226-229	4
β-strand	232-239	8	2
β-strand	247-251	5	2
β-strand	283-290	8	2
α-helix	292-294	3
β-strand	295-296	2	3
β-strand	299-300	2	3

Chain H: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	11-13	3	5
β-strand	19-26	8	4
β-strand	34-40	7	5
β-strand	46-53	8	5
β-strand	58-61	4	5
β-strand	70-74	5	4
α-helix	75-77	3
β-strand	79-84	6	4
α-helix	89-91	3
β-strand	93-100	8	5
β-strand	108-109	2	5
β-strand	113-117	5	5
α-helix	120-122	3
β-strand	123	1	6
α-helix	124-125	2
β-strand	126-130	5	7
β-strand	141-151	11	7
β-strand	152	1	6
β-strand	157-160	4	8
α-helix	161-163	3
β-strand	165	1	8
β-strand	170-171	2	7
α-helix	172-174	3
β-strand	175-176	2	7
β-strand	182-191	10	7
α-helix	192-194	3
β-strand	195	1	9
β-strand	198	1	9
β-strand	201-206	6	8
α-helix	207-209	3
β-strand	211-216	6	8

Chain L: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	10
β-strand	10-13	4	11
β-strand	19-29	11	10
α-helix	31-33	3
β-strand	34-39	6	11
β-strand	46-50	5	11
β-strand	54-55	2	11
α-helix	56	1
β-strand	63-76	14	10
α-helix	81-83	3
β-strand	86-91	6	11
β-strand	94-95	2	11
β-strand	99-103	5	11
β-strand	108	1	12
α-helix	109-110	2
β-strand	111-115	5	13
α-helix	116-118	3
α-helix	119-122	4
β-strand	126-136	11	13
β-strand	137	1	12
β-strand	142-147	6	14
β-strand	150-151	2	14
α-helix	152	1
β-strand	156-160	5	13
β-strand	170-179	10	13
α-helix	180-183	4
β-strand	188-194	7	14
β-strand	202-207	6	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-13 receptor subunit alpha-1	A	protein	122	Homo sapiens	P78552 (AlphaFold model)
Fab heavy chain	H	protein	227	Homo sapiens
Fab light chain	L	protein	212	Homo sapiens

Sequence of entity 1 (A), FASTA

>4HWB_1 Interleukin-13 receptor subunit alpha-1 (chains A)
TSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKC
ENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIHHHHHH
HH

Sequence of entity 2 (H), FASTA

>4HWB_2 Fab heavy chain (chains H)
AEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGVIYPGDSYTR
YSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARMPNWGSFDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHL

Sequence of entity 3 (L), FASTA

>4HWB_3 Fab light chain (chains L)
EVVLTQSPGTLSLSPGERATLSCRASQSISSSYLAWYQQKPGQAPRLLIYGASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYETFGQGTKVEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK
ADYEKHKVYACEVTHQGLSSPVTKSFNRGECA

Ligands and cofactors

ID	Name	Formula	Copies
NHE	2-[N-cyclohexylamino]ethane sulfonic acid	C8 H17 N O3 S	5

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structure of ectodomain 3 of the IL-13 receptor alpha 1 in complex with a human neutralizing monoclonal antibody fragment. Redpath, N.T., Xu, Y., Wilson, N.J. et al. Biochem J (2013) 451:165-175. DOI 10.1042/BJ20121819 · PubMed

Other PDB entries of the same protein (UniProt P78552 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3BPN 3.02 Å, Crystal structure of the IL4-IL4R-IL13Ra ternary complex

Browse structure collections

About this viewer

MolViewer shows 4HWB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.