4HXI: KLHL3/Cul3 complex

Crystal structure of KLHL3/Cul3 complex. Determined by X-ray diffraction at 3.51 Å resolution. Released 13 Mar 2013.

Method: X-ray diffraction
Resolution: 3.51 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,339
Mol. weight: 76.58 kDa
Released: 13 Mar 2013

Explore 4HXI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HXI contains 39 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	33-45	13
β-strand	52-55	4	1
β-strand	60-63	4	1
α-helix	65-71	7
α-helix	73-79	7
α-helix	84-87	4
β-strand	90-92	3	1
α-helix	98-110	13
α-helix	120-129	10
α-helix	133-145	13
α-helix	153-162	10
α-helix	165-172	8
α-helix	183-189	7
α-helix	194-201	8
α-helix	210-213	4
α-helix	214-222	9

Chain B: 26 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	27-45	19
β-strand	50	1	2
β-strand	52	1	2
α-helix	54-66	13
α-helix	70-84	15
α-helix	85-89	5
α-helix	90-94	5
α-helix	101-122	22
α-helix	124-128	5
α-helix	130-133	4
α-helix	139-147	9
α-helix	148-152	5
α-helix	156-173	18
α-helix	180-193	14
α-helix	199-201	3
α-helix	202-206	5
α-helix	207-227	21
α-helix	230-250	21
α-helix	254-256	3
α-helix	257-264	8
α-helix	265-270	6
α-helix	273-277	5
α-helix	284-289	6
α-helix	293-303	11
α-helix	309-329	21
α-helix	341-354	14
α-helix	355-359	5
α-helix	364-377	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch-like protein 3	A	protein	277	Homo sapiens	Q9UH77 (AlphaFold model)
Cullin-3	B	protein	386	Homo sapiens	Q13618 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HXI_1 Kelch-like protein 3 (chains A)
MHHHHHHSSGVDLGTENLYFQSNARTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDV
EIEAHRVVLAACSPYFCAMFTGDMSESAAAAIEIKDVDGQTLSKLIDYIYTAEIEVTEEN
VQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHF
PEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHV
RLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYH

Sequence of entity 2 (B), FASTA

>4HXI_2 Cullin-3 (chains B)
GLNDIFEAQKIEWHEAMELVPRGSAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFE
ELYRNAYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTA
MVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKG
EVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIK
KVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMRTIVEMENSGLVHMLKNGKTED
LGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYRQGLDDLKSRFDRF
LLESFNNDRLFKQTIAGDFEYFLNLN

Primary citation

Crystal structure of KLHL3 in complex with Cullin3. Ji, A.X., Prive, G.G. PLoS One (2013) 8:e60445-e60445. DOI 10.1371/journal.pone.0060445 · PubMed

Other PDB entries of the same protein (UniProt Q9UH77 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CH9 1.84 Å, Crystal structure of the human KLHL3 Kelch domain in complex with a WNK4 peptide
5NKP 2.8 Å, Crystal structure of the human KLHL3 Kelch domain in complex with a WNK3 peptide

Browse structure collections

About this viewer

MolViewer shows 4HXI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.