Crystal structure of the Legionella pneumophila GAP domain of LepB. Determined by X-ray diffraction at 2.8 Å resolution. Released 16 Jan 2013.
Explore 4I1M in 3D Show helices and sheets RCSB PDB PDBe
4I1M contains 48 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 326-328 | 3 | |
| β-strand | 329 | 1 | 1 |
| α-helix | 339-351 | 13 | |
| β-strand | 360 | 1 | 1 |
| α-helix | 367-387 | 21 | |
| α-helix | 404-406 | 3 | |
| β-strand | 413-414 | 2 | 2 |
| β-strand | 417-418 | 2 | 2 |
| β-strand | 423 | 1 | 3 |
| α-helix | 425-433 | 9 | |
| β-strand | 436 | 1 | 4 |
| β-strand | 442 | 1 | 4 |
| α-helix | 446-458 | 13 | |
| α-helix | 463-489 | 27 | |
| α-helix | 494-521 | 28 | |
| β-strand | 538 | 1 | 3 |
| α-helix | 543-548 | 6 | |
| α-helix | 551-561 | 11 | |
| α-helix | 569-576 | 8 | |
| α-helix | 578-580 | 3 | |
| α-helix | 581-589 | 9 | |
| α-helix | 600-614 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 328-329 | 2 | 5 |
| α-helix | 339-351 | 13 | |
| α-helix | 355-357 | 3 | |
| β-strand | 359-360 | 2 | 5 |
| α-helix | 367-387 | 21 | |
| α-helix | 404-406 | 3 | |
| β-strand | 413-414 | 2 | 6 |
| β-strand | 417-418 | 2 | 6 |
| β-strand | 423 | 1 | 7 |
| α-helix | 425-433 | 9 | |
| β-strand | 435 | 1 | 8 |
| α-helix | 441 | 1 | |
| β-strand | 442 | 1 | 8 |
| α-helix | 443 | 1 | |
| α-helix | 446-458 | 13 | |
| α-helix | 463-489 | 27 | |
| α-helix | 493-519 | 27 | |
| β-strand | 538 | 1 | 7 |
| α-helix | 543-548 | 6 | |
| α-helix | 551-561 | 11 | |
| α-helix | 567-568 | 2 | |
| α-helix | 569-576 | 8 | |
| α-helix | 581-588 | 8 | |
| α-helix | 600-614 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 318-325 | 8 | |
| β-strand | 327-329 | 3 | 9 |
| α-helix | 339-352 | 14 | |
| α-helix | 355-357 | 3 | |
| β-strand | 358-360 | 3 | 9 |
| α-helix | 367-387 | 21 | |
| α-helix | 404-406 | 3 | |
| β-strand | 414 | 1 | 10 |
| β-strand | 417 | 1 | 10 |
| β-strand | 423 | 1 | 11 |
| α-helix | 425-432 | 8 | |
| α-helix | 446-458 | 13 | |
| α-helix | 463-489 | 27 | |
| α-helix | 493-517 | 25 | |
| α-helix | 518-521 | 4 | |
| α-helix | 523-524 | 2 | |
| α-helix | 527-530 | 4 | |
| β-strand | 538 | 1 | 11 |
| α-helix | 543-548 | 6 | |
| α-helix | 551-561 | 11 | |
| α-helix | 567-568 | 2 | |
| α-helix | 569-576 | 8 | |
| α-helix | 578-590 | 13 | |
| α-helix | 600-615 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LepB | A, B, C | protein | 302 | Legionella pneumophila subsp. pneumophila | Q5ZSM7 |
>4I1M_1 LepB (chains A, B, C) EELYQSILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNL YVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVD PNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAV TENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLAT ICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQI SG
Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB. Mihai Gazdag, E., Streller, A., Haneburger, I. et al. EMBO Rep (2013) 14:199-205. DOI 10.1038/embor.2012.211 · PubMed
Other PDB entries of the same protein (UniProt Q5ZSM7), best resolution first:
MolViewer shows 4I1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.