Ebola virus VP35 bound to small molecule. Determined by X-ray diffraction at 1.95 Å resolution. Released 19 Mar 2014.
Explore 4IBE in 3D Show helices and sheets RCSB PDB PDBe
4IBE contains 19 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 221-230 | 10 | |
| α-helix | 238-252 | 15 | |
| α-helix | 256-268 | 13 | |
| α-helix | 273-283 | 11 | |
| α-helix | 285-287 | 3 | |
| α-helix | 290-293 | 4 | |
| β-strand | 294-296 | 3 | 1 |
| α-helix | 300-302 | 3 | |
| α-helix | 305-310 | 6 | |
| β-strand | 311-312 | 2 | 1 |
| α-helix | 320-322 | 3 | |
| β-strand | 324-329 | 6 | 1 |
| β-strand | 335-339 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 218-220 | 3 | |
| α-helix | 221-231 | 11 | |
| α-helix | 238-252 | 15 | |
| α-helix | 256-268 | 13 | |
| α-helix | 273-283 | 11 | |
| α-helix | 290-293 | 4 | |
| β-strand | 294-296 | 3 | 2 |
| α-helix | 300-302 | 3 | |
| α-helix | 305-310 | 6 | |
| β-strand | 311-312 | 2 | 2 |
| α-helix | 313-315 | 3 | |
| α-helix | 320-322 | 3 | |
| β-strand | 324-329 | 6 | 2 |
| β-strand | 335-339 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase cofactor VP35 | A, B | protein | 129 | Ebola virus | Q05127 (AlphaFold model) |
>4IBE_1 Polymerase cofactor VP35 (chains A, B) GHMGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGD SPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQ DGKTLGLKI
| ID | Name | Formula | Copies |
|---|---|---|---|
| 11Y | 5-[(2R)-3-benzoyl-2-(4-bromothiophen-2-yl)-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrro… | C22 H13 Br Cl N O5 S | 2 |
Water and common crystallization additives (GOL) are not listed.
In Silico Derived Small Molecules Bind the Filovirus VP35 Protein and Inhibit Its Polymerase Cofactor Activity. Brown, C.S., Lee, M.S., Leung, D.W. et al. J Mol Biol (2014) 426:2045-2058. DOI 10.1016/j.jmb.2014.01.010 · PubMed
Other PDB entries of the same protein (UniProt Q05127 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IBE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.