Ubiquitin-like domain of human tubulin folding cofactor E - crystal form B. Determined by X-ray diffraction at 1.45 Å resolution. Released 18 Jun 2014.
Explore 4ICV in 3D Show helices and sheets RCSB PDB PDBe
4ICV contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 445-451 | 7 | 1 |
| α-helix | 457-459 | 3 | |
| β-strand | 461-466 | 6 | 1 |
| β-strand | 470 | 1 | 2 |
| α-helix | 471-482 | 12 | |
| α-helix | 486-488 | 3 | |
| β-strand | 490-494 | 5 | 1 |
| β-strand | 503-504 | 2 | 1 |
| β-strand | 511 | 1 | 2 |
| α-helix | 513-515 | 3 | |
| β-strand | 522-526 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tubulin-specific chaperone E | A | protein | 85 | Homo sapiens | Q15813 (AlphaFold model) |
>4ICV_1 Tubulin-specific chaperone E (chains A) NQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGRE IELENDLKSLQFYSVENGDCLLVRW
| ID | Name | Formula | Copies |
|---|---|---|---|
| PR | Praseodymium ion | Pr | 3 |
The structure of the complex between alpha-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism. Serna, M., Carranza, G., Martin-Benito, J. et al. J Cell Sci (2015) 128:1824-1834. DOI 10.1242/jcs.167387 · PubMed
Other PDB entries of the same protein (UniProt Q15813 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ICV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.