Crystal structure of SHH1 SAWADEE domain in complex with H3K9me1 peptide. Determined by X-ray diffraction at 2.7 Å resolution. Released 1 May 2013.
Explore 4IUU in 3D Show helices and sheets RCSB PDB PDBe
4IUU contains 14 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 129-132 | 4 | 1 |
| β-strand | 139-150 | 12 | 1 |
| β-strand | 156-162 | 7 | 1 |
| α-helix | 163 | 1 | |
| β-strand | 171-174 | 4 | 1 |
| α-helix | 175-178 | 4 | |
| β-strand | 179-181 | 3 | 1 |
| α-helix | 182-183 | 2 | |
| β-strand | 184-185 | 2 | 2 |
| α-helix | 188-193 | 6 | |
| β-strand | 199-205 | 7 | 2 |
| β-strand | 210-221 | 12 | 2 |
| β-strand | 233-238 | 6 | 2 |
| β-strand | 244-247 | 4 | 2 |
| α-helix | 249-251 | 3 | |
| β-strand | 252-254 | 3 | 2 |
| α-helix | 255-256 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 129-132 | 4 | 3 |
| β-strand | 139-141 | 3 | 3 |
| β-strand | 142-150 | 9 | 4 |
| β-strand | 156-162 | 7 | 4 |
| α-helix | 167-169 | 3 | |
| β-strand | 171-174 | 4 | 4 |
| α-helix | 175-178 | 4 | |
| β-strand | 179-181 | 3 | 3 |
| α-helix | 182-183 | 2 | |
| β-strand | 184-185 | 2 | 5 |
| α-helix | 186-187 | 2 | |
| α-helix | 191-193 | 3 | |
| β-strand | 199-205 | 7 | 5 |
| β-strand | 210-221 | 12 | 5 |
| β-strand | 233-238 | 6 | 5 |
| β-strand | 244-247 | 4 | 5 |
| α-helix | 249-251 | 3 | |
| β-strand | 252-254 | 3 | 5 |
| α-helix | 255-256 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-7 | 4 | |
| β-strand | 8 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sawadee homeodomain homolog 1 | A, B | protein | 135 | Arabidopsis thaliana | Q9XI47 (AlphaFold model) |
| Histone H3.2, H3(1-15)K9me3 | C | protein | 15 | Arabidopsis thaliana | P59226 (AlphaFold model) |
>4IUU_1 SAWADEE HOMEODOMAIN HOMOLOG 1 (chains A, B) SADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGFDNRHDEWVNVKTSVRERS IPVEPSECGRVNVGDLLLCFQEREDQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNT EESLGLERICRRPEE
>4IUU_2 Histone H3.2, H3(1-15)K9me3 (chains C) ARTKQTARKSTGGKA
Polymerase IV occupancy at RNA-directed DNA methylation sites requires SHH1. Law, J.A., Du, J., Hale, C.J. et al. Nature (2013) 498:385-389. DOI 10.1038/nature12178 · PubMed
Other PDB entries of the same protein (UniProt Q9XI47 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IUU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.