Crystal structure of XIAP-BIR2 domain. Determined by X-ray diffraction at 1.45 Å resolution. Released 25 Sept 2013.
Explore 4J3Y in 3D Show helices and sheets RCSB PDB PDBe
4J3Y contains 11 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 158-161 | 4 | |
| α-helix | 163-168 | 6 | |
| α-helix | 169-172 | 4 | |
| α-helix | 181-186 | 6 | |
| β-strand | 189-191 | 3 | 1 |
| β-strand | 198-200 | 3 | 1 |
| β-strand | 206-207 | 2 | 1 |
| α-helix | 216-223 | 8 | |
| α-helix | 228-232 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 159-161 | 3 | |
| α-helix | 163-168 | 6 | |
| α-helix | 181-186 | 6 | |
| β-strand | 189-191 | 3 | 2 |
| β-strand | 198-200 | 3 | 2 |
| β-strand | 206-207 | 2 | 2 |
| α-helix | 216-223 | 8 | |
| α-helix | 228-233 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase XIAP | A, C | protein | 86 | Homo sapiens | P98170 (AlphaFold model) |
>4J3Y_1 E3 ubiquitin-protein ligase XIAP (chains A, C) GTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNW EPGDRAWSEHRRHFPNCFFVLGRNLN
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
The structure of XIAP BIR2: understanding the selectivity of the BIR domains. Lukacs, C., Belunis, C., Crowther, R. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:1717-1725. DOI 10.1107/S0907444913016284 · PubMed
Other PDB entries of the same protein (UniProt P98170 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4J3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.