4J4L: PDB entry 4J4L

Modular evolution and design of the protein binding interface. Determined by X-ray diffraction at 2.3 Å resolution. Released 12 Feb 2014.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Listeria monocytogenes, synthetic construct, Eptatretus burgeri
Chains: 4
Atoms: 6,751
Mol. weight: 98.51 kDa
Released: 12 Feb 2014

Explore 4J4L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J4L contains 35 α-helices and 35 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	44-47	4
α-helix	51-61	11
α-helix	72-77	6
β-strand	80-83	4	1
β-strand	90	1	2
α-helix	94-96	3
β-strand	102-107	6	1
β-strand	112	1	2
α-helix	114-116	3
β-strand	124-129	6	1
β-strand	148-151	4	1
α-helix	159-160	2
β-strand	172-174	3	1
β-strand	196-198	3	1
β-strand	220-222	3	1
β-strand	244-246	3	1
β-strand	252	1	3
α-helix	260-268	9
β-strand	273	1	1
β-strand	274	1	4
β-strand	280	1	4
β-strand	286	1	5
β-strand	287	1	3
β-strand	293	1	5
α-helix	294-296	3

Chain B: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	44-47	4
α-helix	51-61	11
α-helix	72-76	5
β-strand	80-83	4	6
β-strand	90	1	7
α-helix	94-96	3
β-strand	102-107	6	6
β-strand	112	1	7
α-helix	114-118	5
β-strand	124-129	6	6
α-helix	135-136	2
β-strand	148-151	4	6
β-strand	172-174	3	6
β-strand	182	1	8
α-helix	183-184	2
β-strand	196-198	3	6
β-strand	206	1	8
α-helix	207-208	2
β-strand	220-222	3	6
β-strand	244-246	3	6
β-strand	252	1	9
α-helix	260-269	10
β-strand	273-274	2	6
β-strand	280	1	6
α-helix	282-284	3
β-strand	286	1	10
β-strand	287	1	9
β-strand	293	1	10
α-helix	294-296	3

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	18-47	30
α-helix	69-71	3
α-helix	80-99	20
α-helix	109-129	21
α-helix	138-140	3
α-helix	141-152	12
α-helix	156-181	26

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	20-44	25
α-helix	55-58	4
α-helix	59-61	3
α-helix	69-71	3
α-helix	80-102	23
α-helix	109-127	19
α-helix	138-140	3
α-helix	141-152	12
α-helix	156-181	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Internalin B,REPEAT MODULES,Variable lymphocyte receptor B	A, B	protein	267	Listeria monocytogenes, synthetic construct, Eptatretus burgeri	A4L9V2 (AlphaFold model), Q4G1L3 (AlphaFold model)
Interleukin-6	C, D	protein	168	Homo sapiens	P05231 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4J4L_1 Internalin B,REPEAT MODULES,Variable lymphocyte receptor B (chains A, B)
PIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRY
LALGGNKLHDISALKELTNLTYLTLEPNQLQSLPNGVFDKLTNLKELQLWANQLQSLPDG
VFDKLTNLTYLNLAFNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPKGVFDKLTQLKDLR
LYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRNSAGSVAP
DSAKCSGSGKPVRSIICPTLEHHHHHH

Sequence of entity 2 (C, D), FASTA

>4J4L_2 Interleukin-6 (chains C, D)
GSLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQS
GFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAI
TTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Primary citation

Modular evolution and design of the protein binding interface. Lee, J., Kim, H.J., Yang, C. et al. To be published.

Browse structure collections

About this viewer

MolViewer shows 4J4L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.