4J5M: Cargo Binding Domain from Human Myosin Vb

Structure of the Cargo Binding Domain from Human Myosin Vb. Determined by X-ray diffraction at 2.07 Å resolution. Released 9 Oct 2013.

Method: X-ray diffraction
Resolution: 2.07 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,181
Mol. weight: 45.63 kDa
Released: 9 Oct 2013

Explore 4J5M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J5M contains 22 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1464-1466	3
β-strand	1470-1471	2	1
α-helix	1474-1476	3
α-helix	1477-1481	5
α-helix	1482-1486	5
α-helix	1490-1493	4
α-helix	1500-1514	15
α-helix	1518-1538	21
α-helix	1543-1562	20
α-helix	1567-1569	3
α-helix	1575-1578	4
α-helix	1588-1622	35
α-helix	1654-1670	17
α-helix	1675-1699	25
α-helix	1701-1703	3
α-helix	1706-1725	20
α-helix	1733-1736	4
α-helix	1738-1746	9
α-helix	1754-1763	10
α-helix	1769-1778	10
α-helix	1787-1790	4
α-helix	1791-1800	10
α-helix	1838-1840	3
β-strand	1846-1847	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Vb	A	protein	396	Homo sapiens	Q9ULV0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4J5M_1 Unconventional myosin-Vb (chains A)
LNRQVTVQRKEKDFQGMLEYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHA
DYTNDDLKVHSLLTSTINGIKKVLKKHNDDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQ
NTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIKIAEGVLQPMIVSAMLENESIQGLSG
VKPTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTVMCDQGLDPEIILQVFKQLFYMINAV
TLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGAVQTMEPLIQAAQLLQLKKK
TQEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVAFIRTIQAQLQERNDPQQLLL
DAKHMFPVLFPFNPSSLTMDSIHIPACLNLEFLNEV

Primary citation

Structural Insights into Functional Overlapping and Differentiation among Myosin V Motors. Nascimento, A.F., Trindade, D.M., Tonoli, C.C. et al. J Biol Chem (2013) 288:34131-34145. DOI 10.1074/jbc.M113.507202 · PubMed

Other PDB entries of the same protein (UniProt Q9ULV0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
4LWZ 2.55 Å, Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a
4LNZ 3.11 Å, Crystal structure of human Myosin 5b globular domain

Browse structure collections

About this viewer

MolViewer shows 4J5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.