4J7F: SET7/9Y335pAF

SET7/9Y335pAF in complex with TAF10 peptide and AdoHcy. Determined by X-ray diffraction at 1.59 Å resolution. Released 26 Mar 2014.

Method: X-ray diffraction
Resolution: 1.59 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,137
Mol. weight: 30.68 kDa
Ligands: SAH
Released: 26 Mar 2014

Explore 4J7F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J7F contains 8 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	118-122	5	1
β-strand	128-132	5	1
β-strand	141-147	7	1
β-strand	153-160	8	1
β-strand	163-176	14	1
β-strand	179-184	6	1
α-helix	185	1
β-strand	190-191	2	1
α-helix	210-213	4
β-strand	216-220	5	2
β-strand	228-232	5	2
β-strand	236	1	3
β-strand	241-245	5	4
β-strand	248-250	3	5
α-helix	252-256	5
α-helix	260-262	3
β-strand	267-268	2	5
β-strand	274-276	3	5
α-helix	292-294	3
α-helix	295	1
β-strand	296-297	2	4
β-strand	303-310	8	4
β-strand	314-321	8	4
β-strand	325	1	3
α-helix	329	1
β-strand	330-331	2	2
β-strand	332-333	2	4
α-helix	351-361	11

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	189	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase SETD7	A	protein	261	Homo sapiens	Q8WTS6 (AlphaFold model)
Transcription initiation factor TFIID subunit 10	B	protein	11	Homo sapiens	Q12962 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4J7F_1 Histone-lysine N-methyltransferase SETD7 (chains A)
GAMGYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMI
EGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISS
AGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVS
KYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAXGYDHSPPGKS
GPEAPEWYQVELKAFQATQQK

Sequence of entity 2 (B), FASTA

>4J7F_2 Transcription initiation factor TFIID subunit 10 (chains B)
XSKSKDRKYTL

Ligands and cofactors

ID	Name	Formula	Copies
SAH	S-adenosyl-L-homocysteine	C14 H20 N6 O5 S	1

Primary citation

Methyl CH O Hydrogen Bonds Orchestrate AdoMet-Dependent Methylation. Horowitz, S., Dirk, L.M.A., Yesselman, J.D. et al. To be published.

Other PDB entries of the same protein (UniProt Q8WTS6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F69 1.3 Å, Ternary complex of SET7/9 bound to AdoHcy and a TAF10 peptide
3M58 1.4 Å, SET7/9 Y245A in complex with TAF10-K189me1 peptide and AdoHcy
3CBP 1.42 Å, Set7/9-ER-Sinefungin complex
3M55 1.55 Å, SET7/9 Y305F in complex with TAF10-K189me1 peptide and AdoHcy
5EG2 1.55 Å, SET7/9 N265A in complex with AdoHcy and TAF10 peptide
3M54 1.6 Å, SET7/9 Y305F in complex with TAF10 peptide and AdoHcy
4J8O 1.63 Å, SET7/9 in complex with TAF10K189A peptide and AdoHcy
3CBO 1.65 Å, SET7/9-ER-AdoHcy complex
3M56 1.65 Å, SET7/9 Y305F in complex with TAF10-K189me2 peptide and AdoHcy
3CBM 1.69 Å, SET7/9-ER-AdoMet complex
3OS5 1.69 Å, SET7/9-Dnmt1 K142me1 complex
5YLT 1.69 Å, Crystal structure of SET7/9 in complex with a cyproheptadine derivative

Browse structure collections

About this viewer

MolViewer shows 4J7F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.