4JHB: RelB double mutants: Y300F/I335F

Crystal structure of RelB double mutants: Y300F/I335F. Determined by X-ray diffraction at 2.44 Å resolution. Released 4 Sept 2013.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,049
Mol. weight: 12.42 kDa
Released: 4 Sept 2013

Explore 4JHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JHB contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	270-272	3	1
β-strand	275-277	3	1
β-strand	283-286	4	2
β-strand	290-292	3	1
β-strand	298-303	6	2
β-strand	312-316	5	1
β-strand	321-323	3	1
β-strand	325	1	2
α-helix	328-330	3
β-strand	331-332	2	2
β-strand	336-340	5	2
α-helix	341-344	4
β-strand	353-360	8	1
β-strand	367	1	1
α-helix	368-370	3
β-strand	371-376	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor RelB	A	protein	110	Mus musculus	Q04863 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JHB_1 Transcription factor RelB (chains A)
LVPRGSHMNTSELRICRINKESGPCTGGEELFLLCDKVQKEDISVVFSTASWEGRADFSQ
ADVHRQFAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR

Primary citation

Crystal structure of RelB double mutants: Y300F/I335F. Huang, D.B., Vu, D., Ghosh, G. To be published.

Other PDB entries of the same protein (UniProt Q04863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZK9 2.18 Å, NF-kB RelB forms an intertwined homodimer
1ZKA 2.2 Å, NF-kB RelB forms an intertwined homodimer, Y300S mutant
3JUZ 2.51 Å, Crystal structure of a mutant of RelB dimerization domain(M5)
3JSS 2.6 Å, Crystal structure of a mutant RelB dimerization domain
3JV0 2.65 Å, Crystal structure of a mutant of RelB dimerization domain(M6)
3JV6 2.78 Å, Crystal structure of the dimerization domains p52 and RelB
4JGM 3.0 Å, Crystal structure of RelB double mutants: Y300F/I335V
2V2T 3.05 Å, X-ray structure of a NF-kB p50-RelB-DNA complex
3DO7 3.05 Å, X-ray structure of a NF-kB p52/RelB/DNA complex
3JV4 3.15 Å, Crystal structure of the dimerization domains p50 and RelB

Browse structure collections

About this viewer

MolViewer shows 4JHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.