4JJH: Poliovirus receptor-related protein 4

Crystal structure of the D1 domain from human Nectin-4 extracellular fragment [PSI-NYSGRC-005624]. Determined by X-ray diffraction at 2.25 Å resolution. Released 27 Mar 2013.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,727
Mol. weight: 28.94 kDa
Released: 27 Mar 2013

Explore 4JJH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JJH contains 8 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	39-43	5	1
β-strand	48-50	3	2
β-strand	53	1	3
β-strand	62-69	8	1
β-strand	77-83	7	1
β-strand	87-90	4	1
α-helix	92-94	3
β-strand	98-99	2	2
α-helix	100-102	3
β-strand	109	1	3
β-strand	112-114	3	2
α-helix	119-121	3
β-strand	123-131	9	1
β-strand	136-146	11	1
α-helix	147-151	5

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	39-43	5	4
β-strand	48-50	3	5
β-strand	53	1	6
β-strand	61-69	9	4
β-strand	77-83	7	4
β-strand	87-90	4	4
α-helix	92-94	3
β-strand	98-99	2	5
α-helix	100-101	2
β-strand	109	1	6
β-strand	112-114	3	5
α-helix	119-121	3
β-strand	123-132	10	4
β-strand	136-146	11	4
α-helix	147-151	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poliovirus receptor-related protein 4	A, B	protein	133	Homo sapiens	Q96NY8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4JJH_1 Poliovirus receptor-related protein 4 (chains A, B)
QDYGGGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKY
GLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVL
VPPLPSLAENLYF

Primary citation

Crystal structure of the D1 domain of human Nectin-4 extracellular fragment [NYSGRC-005624]. Kumar, P.R., Nathenson, S.G., Almo, S.C. et al. To be published.

Other PDB entries of the same protein (UniProt Q96NY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9UCL 2.43 Å, CryoEM structure of IgV domain of human Nectin-4 with Trimbody
4GJT 3.1 Å, complex structure of nectin-4 bound to MV-H
9KKJ 3.26 Å, Structure of Nectin-4 D1 domain in complex with the Fab fragment of 9MW2821 mAb
4FRW 3.5 Å, Crystal structure of human nectin-4 extracellular fragment D1-D2

Browse structure collections

About this viewer

MolViewer shows 4JJH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.