Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain of NHERF1. Determined by X-ray diffraction at 1.16 Å resolution. Released 23 Oct 2013.
Explore 4JL7 in 3D Show helices and sheets RCSB PDB PDBe
4JL7 contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12 | 1 | |
| β-strand | 13-18 | 6 | 1 |
| β-strand | 20 | 1 | 2 |
| β-strand | 23 | 1 | 2 |
| β-strand | 27-30 | 4 | 1 |
| β-strand | 37-40 | 4 | 1 |
| α-helix | 47-50 | 4 | |
| α-helix | 57 | 1 | |
| β-strand | 58-62 | 5 | 1 |
| β-strand | 65-66 | 2 | 1 |
| α-helix | 72-81 | 10 | |
| β-strand | 85-91 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | A | protein | 91 | Homo sapiens | O14745 (AlphaFold model) |
>4JL7_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (chains A) GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVE KETHQQVVSRIRAALNAVRLLVVDPETSTTL
Structural Insights into Neutrophilic Migration Revealed by the Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain of NHERF1. Lu, G., Wu, Y., Jiang, Y. et al. PLoS One (2013) 8:e76219-e76219. DOI 10.1371/journal.pone.0076219 · PubMed
Other PDB entries of the same protein (UniProt O14745 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4JL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.