4JNF: Hsp70 CHAPERONE DnaK

Name: PDB 4JNF: Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP
Published: 2013-05-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP. Determined by X-ray diffraction at 1.62 Å resolution. Released 29 May 2013.

Method: X-ray diffraction
Resolution: 1.62 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,928
Mol. weight: 24 kDa
Released: 29 May 2013

Explore 4JNF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JNF contains 10 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	394	1	1
β-strand	399-403	5	2
β-strand	407-412	6	2
β-strand	417	1	1
β-strand	420-426	7	3
β-strand	436-442	7	2
β-strand	447	1	2
α-helix	448-450	3
β-strand	452-459	8	2
α-helix	463-465	3
α-helix	466-468	3
β-strand	472-478	7	3
β-strand	484-490	7	3
β-strand	496-500	5	3
α-helix	503-505	3
α-helix	509-521	13
α-helix	523-553	31
α-helix	554-556	3
α-helix	559-576	18
α-helix	581-593	13
α-helix	596-603	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hsp70 CHAPERONE DnaK	A	protein	221	Escherichia coli	P0A6Y8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JNF_1 Hsp70 CHAPERONE DnaK (chains A)
SVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSMGGAVTIHVLQGERKRAADN
KSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDE
IQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTA
LETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQHA

Primary citation

Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP. Qi, R., Sarbeng, E.B., Liu, Q. et al. Nat Struct Mol Biol (2013) 20:900-907. DOI 10.1038/nsmb.2583 · PubMed

Other PDB entries of the same protein (UniProt P0A6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4F01 1.4 Å, Crystal structure of an artificial dimeric DnaK complex
7RAX 1.41 Å, ATP-binding state of the nucleotide-binding domain of Hsp70 DnaK mutant T199A
13JG 1.52 Å, E. coli DnaK bound to peptide PA1, structure B
4HY9 1.55 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4EZP 1.65 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4EZX 1.7 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with the…
4HYB 1.7 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4R5K 1.75 Å, Crystal structure of the DnaK C-terminus (Dnak-SBD-B)
4EZN 1.8 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with…
4EZW 1.8 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with the…
4JWC 1.8 Å, Crystal structure of the substrate binding domain of E.coli DnaK in complex with bovine…
7KRU 1.82 Å, Stimulating state of a truncated Hsp70 DnaK fused with a substrate peptide

Browse structure collections

About this viewer

MolViewer shows 4JNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.