4JQI: Active beta-arrestin1

Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 17 Apr 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 4
Atoms: 5,858
Mol. weight: 98.11 kDa
Ligands: PRO
Released: 17 Apr 2013

Explore 4JQI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JQI contains 23 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-43	7	1
β-strand	53-63	11	4
β-strand	73-87	15	4
α-helix	90	1
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	123-125	3
β-strand	127-129	3	4
α-helix	130-132	3
α-helix	138-140	3
β-strand	141-150	10	4
α-helix	157-159	3
α-helix	160-162	3
β-strand	163-168	6	4
β-strand	169-171	3	2
β-strand	183-188	6	5
β-strand	197-203	7	5
β-strand	207-208	2	6
β-strand	214-222	9	5
β-strand	228-242	15	7
β-strand	246-258	13	7
β-strand	262	1	7
β-strand	266-274	9	5
β-strand	288-290	3	4
α-helix	291-292	2
α-helix	299	1
β-strand	300	1	4
α-helix	301-306	6
β-strand	316-329	14	7
β-strand	343-349	7	7
β-strand	350-351	2	6
α-helix	353-356	4

Chain H: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	8
β-strand	13-15	3	9
β-strand	21-28	8	8
β-strand	35-42	8	9
β-strand	48-55	8	9
β-strand	60-63	4	9
β-strand	71-76	6	8
β-strand	81-86	6	8
α-helix	91-93	3
β-strand	95-103	9	9
β-strand	112-113	2	9
β-strand	117-121	5	9
α-helix	124-126	3
β-strand	127	1	10
β-strand	130-134	5	11
β-strand	147-155	9	11
β-strand	156	1	10
β-strand	161-164	4	12
β-strand	173-175	3	11
α-helix	176-178	3
β-strand	179-180	2	11
β-strand	186-193	8	11
β-strand	205-210	6	12
α-helix	211-213	3
β-strand	215-220	6	12

Chain L: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	5-8	4	13
β-strand	11-14	4	14
β-strand	20-26	7	13
β-strand	34-39	6	14
β-strand	46-50	5	14
β-strand	54-55	2	14
α-helix	56	1
β-strand	63-68	6	13
β-strand	71-76	6	13
β-strand	86-91	6	14
α-helix	97	1
β-strand	98-99	2	14
β-strand	103-107	5	14
β-strand	115-119	5	15
α-helix	120-122	3
α-helix	123-126	4
β-strand	130-140	11	15
β-strand	160-164	5	15
β-strand	168	1	16
β-strand	173	1	16
β-strand	174-183	10	15
α-helix	184-189	6

Chain V: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	349-351	3	4
α-helix	358-360	3
β-strand	361-364	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	401	Rattus norvegicus	P29066 (AlphaFold model)
Fab30 heavy chain	H	protein	237	Mus musculus
Fab30 light chain	L	protein	215	Mus musculus
Vasopressin V2 receptor phosphopeptide	V	protein	29		P30518 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JQI_1 Beta-arrestin-1 (chains A)
GSPEFPGRLGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERR
VYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHA
YPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQ
YAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIK
ISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGK
LKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLM
HPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFAR

Sequence of entity 2 (H), FASTA

>4JQI_2 Fab30 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (L), FASTA

>4JQI_3 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (V), FASTA

>4JQI_4 Vasopressin V2 receptor phosphopeptide (chains V)
ARGRTPPSLGPQDESCTTASSSLAKDTSS

Ligands and cofactors

ID	Name	Formula	Copies
PRO	Proline	C5 H9 N O2	1

Water and common crystallization additives (EDO, CL) are not listed.

Primary citation

Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide. Shukla, A.K., Manglik, A., Kruse, A.C. et al. Nature (2013) 497:137-141. DOI 10.1038/nature12120 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HST 2.66 Å, The structure of rat beta-arrestin1
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
6KL7 2.79 Å, Beta-arrestin 1 mutant S13D/T275D
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
8I0N 3.26 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8J8Z 3.4 Å, Structure of beta-arrestin1 in complex with D6Rpp
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor
9DNG 3.52 Å, Structure of rat beta-arrestin 1 by fiducial-assisted cryo-EM

Browse structure collections

About this viewer

MolViewer shows 4JQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.