4JUG: Hemagglutinin

Crystal structure of 1918 pandemic influenza virus hemagglutinin mutant D225G. Determined by X-ray diffraction at 2.7 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Influenza A virus
Chains: 12
Atoms: 23,611
Mol. weight: 334.68 kDa
Released: 1 May 2013

Explore 4JUG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JUG contains 89 α-helices and 310 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
β-strand	12	1	2
β-strand	19-20	2	3
β-strand	28-29	2	3
β-strand	30	1	4
β-strand	33-35	3	5
β-strand	37-38	2	6
β-strand	46-48	3	7
β-strand	49	1	8
β-strand	51	1	8
α-helix	52-53	2
β-strand	54-55	2	9
β-strand	59	1	10
α-helix	61-66	6
α-helix	72-75	4
β-strand	79	1	11
β-strand	83-85	3	9
β-strand	91	1	10
β-strand	99	1	11
α-helix	102-110	9
β-strand	112-119	8	11
α-helix	123-126	4
β-strand	130-131	2	12
β-strand	136-141	6	13
β-strand	144-146	3	13
β-strand	151-153	3	11
β-strand	155-156	2	12
β-strand	164-169	6	14
β-strand	175-184	10	11
α-helix	188-195	8
β-strand	202-205	4	14
β-strand	210-213	4	14
β-strand	223	1	15
β-strand	226	1	15
β-strand	229-237	9	11
α-helix	238	1
β-strand	242-247	6	14
β-strand	251-254	4	11
β-strand	256-262	7	11
β-strand	268-270	3	9
α-helix	274	1
β-strand	275-279	5	7
β-strand	282-283	2	16
β-strand	288	1	16
β-strand	295-296	2	6
β-strand	302	1	17
β-strand	303-304	2	16
β-strand	306	1	18
α-helix	307	1
β-strand	308-309	2	6
β-strand	316-318	3	5
β-strand	322	1	4

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	19
β-strand	510	1	19
β-strand	514	1	2
β-strand	522-527	6	1
β-strand	534-536	3	1
α-helix	538-558	21
α-helix	560-561	2
β-strand	562	1	18
β-strand	565	1	17
α-helix	575-626	52
α-helix	627-629	3
β-strand	630-632	3	1
β-strand	637-640	4	1
α-helix	646-652	7
α-helix	664-669	6

Chain C: 10 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	20
β-strand	12	1	21
β-strand	19-20	2	22
β-strand	28-29	2	22
β-strand	30	1	23
β-strand	33-35	3	24
β-strand	37-38	2	25
β-strand	46-49	4	26
β-strand	51	1	26
α-helix	52-53	2
β-strand	54-55	2	27
β-strand	59	1	28
α-helix	61-66	6
α-helix	69-76	8
β-strand	79	1	29
β-strand	83-85	3	27
β-strand	91	1	28
β-strand	99	1	29
α-helix	102-109	8
β-strand	112-119	8	29
α-helix	123-126	4
β-strand	131	1	30
β-strand	136-141	6	31
β-strand	144-146	3	31
β-strand	151-153	3	29
β-strand	155	1	30
α-helix	162-163	2
β-strand	164-169	6	32
β-strand	176-184	9	29
α-helix	188-195	8
β-strand	202-205	4	32
β-strand	210-213	4	32
β-strand	223	1	33
β-strand	226	1	33
β-strand	229-237	9	29
α-helix	238	1
β-strand	242-247	6	32
β-strand	251-254	4	29
β-strand	256-262	7	29
β-strand	268-270	3	27
α-helix	273-274	2
β-strand	275-280	6	26
β-strand	282-283	2	34
β-strand	288	1	34
β-strand	295-296	2	25
β-strand	302	1	35
β-strand	303-304	2	34
β-strand	306	1	36
α-helix	307	1
β-strand	308-309	2	25
β-strand	316-318	3	24
β-strand	322	1	23

Chain D: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	37
β-strand	510	1	37
β-strand	514	1	21
β-strand	522-527	6	20
β-strand	532-536	5	20
α-helix	538-558	21
α-helix	560-561	2
β-strand	562	1	36
β-strand	565	1	35
α-helix	575-626	52
α-helix	627-629	3
β-strand	630-634	5	20
β-strand	637-640	4	20
α-helix	646-652	7

Chain E: 11 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	38
β-strand	12	1	39
β-strand	19-20	2	40
β-strand	28-29	2	40
β-strand	30	1	41
β-strand	33-35	3	42
β-strand	37-38	2	43
β-strand	46-49	4	44
β-strand	51	1	44
β-strand	54-57	4	45
β-strand	59	1	46
α-helix	61-66	6
α-helix	69-74	6
β-strand	79	1	47
β-strand	83-85	3	45
β-strand	91	1	46
β-strand	99	1	47
α-helix	102-109	8
β-strand	112-119	8	47
α-helix	123-126	4
β-strand	131	1	48
β-strand	136	1	49
α-helix	137-139	3
β-strand	146	1	49
β-strand	151-153	3	47
β-strand	155	1	48
β-strand	164-169	6	50
β-strand	176-184	9	47
α-helix	188-195	8
β-strand	202-205	4	50
β-strand	210-213	4	50
β-strand	223	1	51
β-strand	226	1	51
β-strand	229-237	9	47
α-helix	238	1
β-strand	242-247	6	50
β-strand	251-254	4	47
β-strand	256-262	7	47
β-strand	268-270	3	45
α-helix	274	1
β-strand	275-280	6	44
β-strand	282-284	3	52
β-strand	287-288	2	52
β-strand	295-296	2	43
β-strand	302	1	53
β-strand	303-304	2	52
β-strand	306	1	54
α-helix	307	1
β-strand	308-309	2	43
β-strand	316-318	3	42
α-helix	321	1
β-strand	322	1	41
α-helix	323	1

Chain F: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	55
β-strand	510	1	55
β-strand	514	1	39
β-strand	522-526	5	38
β-strand	533-536	4	38
α-helix	538-557	20
β-strand	562	1	54
β-strand	565	1	53
α-helix	575-626	52
α-helix	627-629	3
β-strand	630-632	3	38
β-strand	637-640	4	38
α-helix	646-654	9

Chain G: 9 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	56
β-strand	12	1	57
β-strand	19-20	2	58
β-strand	28-29	2	58
β-strand	30	1	59
β-strand	33-35	3	60
β-strand	37-38	2	61
β-strand	46-48	3	62
β-strand	49	1	63
β-strand	51	1	63
α-helix	52-53	2
β-strand	54-55	2	64
β-strand	59	1	65
α-helix	61-66	6
α-helix	72-75	4
β-strand	79	1	66
β-strand	83-85	3	64
β-strand	91	1	65
β-strand	99	1	66
α-helix	102-108	7
α-helix	109-111	3
β-strand	112-119	8	66
α-helix	123-126	4
β-strand	131	1	67
β-strand	136-141	6	68
β-strand	144-146	3	68
β-strand	151-153	3	66
β-strand	155	1	67
α-helix	162-163	2
β-strand	164-169	6	69
β-strand	175-184	10	66
α-helix	188-194	7
β-strand	202-205	4	69
β-strand	210-213	4	69
β-strand	223	1	70
β-strand	226	1	70
β-strand	229-237	9	66
β-strand	242-247	6	69
β-strand	251-254	4	66
β-strand	256-262	7	66
β-strand	268-270	3	64
β-strand	275-279	5	62
β-strand	282-283	2	71
β-strand	288-289	2	71
β-strand	295-296	2	61
β-strand	302	1	72
β-strand	303-304	2	71
β-strand	306	1	73
α-helix	307	1
β-strand	308-309	2	61
β-strand	316-318	3	60
β-strand	322	1	59

Chain H: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	74
β-strand	510	1	74
β-strand	514	1	57
β-strand	522-527	6	56
β-strand	532-536	5	56
α-helix	538-558	21
α-helix	560-561	2
β-strand	562	1	73
β-strand	565	1	72
α-helix	575-626	52
α-helix	627-629	3
β-strand	630-632	3	56
β-strand	637-640	4	56
α-helix	646-654	9
α-helix	664-668	5

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin	A, C, E, G, I, K	protein	324	Influenza A virus	Q9WFX3
Hemagglutinin	B, D, F, H, J, L	protein	170	Influenza A virus	Q9WFX3

Sequence of entity 1 (A, C, E, G, I, K), FASTA

>4JUG_1 Hemagglutinin (chains A, C, E, G, I, K)
DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCKLKGIAPLQLGKCNIAGW
LLGNPECDLLLTASSWSYIVETSNSENGTCYPGDFIDYEELREQLSSVSSFEKFEIFPKT
SSWPNHETTKGVTAACSYAGASSFYRNLLWLTKKGSSYPKLSKSYVNNKGKEVLVLWGVH
HPPTGTDQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRGQAGRMNYYWTLLEPGDTI
TFEATGNLIAPWYAFALNRGSGSGIITSDAPVHDCNTKCQTPHGAINSSLPFQNIHPVTI
GECPKYVRSTKLRMATGLRNIPAR

Sequence of entity 2 (B, D, F, H, J, L), FASTA

>4JUG_2 Hemagglutinin (chains B, D, F, H, J, L)
GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMN
TQFTAVGKEFNNLERRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVRNLYE
KVKSQLKNNAKEIGNGCFEFYHKCDDACMESVRNGTYDYPKYSEESKLNR

Primary citation

Molecular basis of the receptor binding specificity switch of the hemagglutinins from both the 1918 and 2009 pandemic influenza A viruses by a D225G substitution. Zhang, W., Shi, Y., Qi, J. et al. J Virol (2013) 87:5949-5958. DOI 10.1128/JVI.00545-13 · PubMed

Other PDB entries of the same protein (UniProt Q9WFX3), best resolution first:

4GXX 1.8 Å, Crystal structure of the "avianized" 1918 influenza virus hemagglutinin
5VMC 2.15 Å, Influenza hemagglutinin H1 mutant DH1 in complex with 6'SLN
3GBN 2.2 Å, Crystal Structure of Fab CR6261 in Complex with the 1918 H1N1 influenza virus…
5VMF 2.35 Å, Influenza hemagglutinin H1 mutant DH1D in complex with 6'SLN
5VMG 2.45 Å, Influenza hemagglutinin H1 mutant DH1E in complex with 6'SLN
4EEF 2.7 Å, Crystal structure of the designed inhibitor protein F-HB80.4 in complex with the 1918…
3LZF 2.8 Å, Crystal Structure of Fab 2D1 in Complex with the 1918 Influenza Virus Hemagglutinin
4JUH 2.81 Å, Crystal structure of 1918 pandemic influenza virus hemagglutinin mutant D225G complexed…
1RUZ 2.9 Å, 1918 H1 Hemagglutinin
4PY8 2.91 Å, Crystal structure of Fab 3.1 in complex with the 1918 influenza virus hemagglutinin
5VMJ 2.95 Å, Influenza hemagglutinin H1 mutant DH1E in complex with 3'SLN
1RD8 3.0 Å, Crystal Structure of the 1918 Human H1 Hemagglutinin Precursor (HA0)

Browse structure collections

About this viewer

MolViewer shows 4JUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.