Crystal structure of LepB GAP domain from Legionella drancourtii in complex with Rab1-GDP and AlF3. Determined by X-ray diffraction at 2.78 Å resolution. Released 8 May 2013.
Explore 4JVS in 3D Show helices and sheets RCSB PDB PDBe
4JVS contains 23 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 335 | 1 | 1 |
| α-helix | 344-355 | 12 | |
| β-strand | 364 | 1 | 1 |
| α-helix | 370-390 | 21 | |
| α-helix | 406-408 | 3 | |
| β-strand | 416-417 | 2 | 2 |
| β-strand | 420-421 | 2 | 2 |
| β-strand | 426 | 1 | 3 |
| α-helix | 428-434 | 7 | |
| α-helix | 437-439 | 3 | |
| β-strand | 445-446 | 2 | 4 |
| α-helix | 447 | 1 | |
| α-helix | 449-451 | 3 | |
| α-helix | 452-461 | 10 | |
| α-helix | 466-487 | 22 | |
| α-helix | 503-524 | 22 | |
| β-strand | 544 | 1 | 3 |
| α-helix | 549-552 | 4 | |
| α-helix | 557-567 | 11 | |
| α-helix | 575-581 | 7 | |
| α-helix | 585-594 | 10 | |
| α-helix | 606-620 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-18 | 9 | 5 |
| α-helix | 24-33 | 10 | |
| β-strand | 41-42 | 2 | 4 |
| α-helix | 43-44 | 2 | |
| β-strand | 46-55 | 10 | 5 |
| β-strand | 58-67 | 10 | 5 |
| α-helix | 71-73 | 3 | |
| α-helix | 74-78 | 5 | |
| β-strand | 86-92 | 7 | 5 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-112 | 11 | |
| β-strand | 118-124 | 7 | 5 |
| α-helix | 136-144 | 9 | |
| β-strand | 150-152 | 3 | 5 |
| β-strand | 154 | 1 | 6 |
| β-strand | 159 | 1 | 6 |
| α-helix | 161-174 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Putative uncharacterized protein | A | protein | 310 | Legionella drancourtii | G9EPL4 (AlphaFold model) |
| Ras-related protein Rab-1A | B | protein | 181 | Homo sapiens | P62820 (AlphaFold model) |
>4JVS_1 Putative uncharacterized protein (chains A) SGRPMTLQSAMGDMYQSIFVATPPLLQMEQEQPFPELIRTWAGLLGQIGVESVRTEEVNF GQLAKCFNDYLNTVAEHCEQQNIWQHKREENHNFFTAFKPDASKAALHGHAYIAHYKESV ILRHLSIVDPKTLGMLRFAPYEAPSTDYCRHFPDSPWAKMQRLATAGQNIILQLRLIQNG QMLEDDFMKEKLPVLQKALDDFMQYKTEVDALLAHDSEVTPVSTHDSSFFYDIDEQTLNA MSGDQLATICFEELNAPHPSRLIMRILKSDSLWQEVDDSLNGDAFMGRQDDICEKRNKIC QWRQLVQMTT
>4JVS_2 Ras-related protein Rab-1A (chains B) SGRPMSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELD GKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASEN VNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM G
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
| AF3 | Aluminum fluoride | Al F3 | 1 |
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 1 |
Water and common crystallization additives (ACY) are not listed.
Structural analyses of Legionella LepB reveal a new GAP fold that catalytically mimics eukaryotic RasGAP. Yu, Q., Hu, L., Yao, Q. et al. Cell Res (2013) 23:775-787. DOI 10.1038/cr.2013.54 · PubMed
MolViewer shows 4JVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.