4JYO: Angiopoietin-1 mediated signaling initiation

Structural basis for angiopoietin-1 mediated signaling initiation. Determined by X-ray diffraction at 2.5 Å resolution. Released 8 May 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,843
Mol. weight: 26.35 kDa
Ligands: CA
Released: 8 May 2013

Explore 4JYO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JYO contains 6 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	7-12	6
β-strand	19-23	5	1
β-strand	32-37	6	1
β-strand	45-51	7	1
α-helix	62-67	6
β-strand	69-70	2	1
β-strand	76-77	2	1
α-helix	80-87	8
β-strand	92-99	8	1
β-strand	105-115	11	1
α-helix	118-120	3
β-strand	124-131	8	1
β-strand	144	1	1
β-strand	147	1	2
β-strand	148	1	3
β-strand	151	1	3
α-helix	160-164	5
β-strand	168	1	2
β-strand	176-177	2	4
β-strand	189	1	5
β-strand	196-197	2	4
β-strand	205	1	5
α-helix	206-207	2
β-strand	209-216	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiopoietin-1	X	protein	230	Homo sapiens	Q15389 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>4JYO_1 Angiopoietin-1 (chains X)
AELASEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGS
LDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHI
GNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGP
SNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDFGSLVPR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structural basis for angiopoietin-1-mediated signaling initiation. Yu, X., Seegar, T.C., Dalton, A.C. et al. Proc Natl Acad Sci U S A (2013) 110:7205-7210. DOI 10.1073/pnas.1216890110 · PubMed

Other PDB entries of the same protein (UniProt Q15389 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IVT 1.75 Å, Crystal structure of Ang1 receptor-binding domain
4EPU 2.1 Å, Ang1 fibrinogen-related domain (FReD)
9IVU 2.28 Å, Crystal structure of Ang1-A451D receptor binding domain
4K0V 4.51 Å, Structural basis for angiopoietin-1 mediated signaling initiation

Browse structure collections

About this viewer

MolViewer shows 4JYO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.