4K3S: E. coli sliding clamp in P1 crystal space group

E. coli sliding clamp in P1 crystal space group. Determined by X-ray diffraction at 1.75 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Escherichia coli
Chains: 2
Atoms: 6,129
Mol. weight: 81.82 kDa
Ligands: CA, P4C
Released: 1 May 2013

Explore 4K3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4K3S contains 28 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	7-17	11
α-helix	29-31	3
β-strand	32-38	7	2
β-strand	41-47	7	2
β-strand	51-58	8	2
β-strand	64	1	1
β-strand	66-71	6	2
α-helix	72-81	10
α-helix	83	1
β-strand	87-93	7	1
β-strand	96-101	6	1
β-strand	104-109	6	1
β-strand	111	1	2
α-helix	113-115	3
α-helix	119-121	3
β-strand	126-131	6	2
α-helix	132-140	9
α-helix	143-145	3
α-helix	153-155	3
β-strand	157-172	16	3
β-strand	176-196	21	3
α-helix	197-206	10
β-strand	213-218	6	2
β-strand	222-227	6	2
β-strand	230-235	6	2
β-strand	237	1	3
α-helix	244-246	3
β-strand	254-259	6	3
α-helix	260-271	12
β-strand	280-286	7	4
β-strand	289-295	7	4
β-strand	301-307	7	4
β-strand	309-311	3	3
β-strand	315-320	6	4
α-helix	321-331	11
β-strand	335-340	6	3
β-strand	347-351	5	3
β-strand	357-361	5	3

Chain B: 15 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	4
α-helix	7-17	11
α-helix	28-31	4
β-strand	32-38	7	5
β-strand	41-47	7	5
β-strand	51-58	8	5
β-strand	64	1	4
β-strand	66-71	6	5
α-helix	72-81	10
α-helix	83	1
β-strand	87-93	7	4
β-strand	96-101	6	4
β-strand	104-109	6	4
β-strand	111	1	5
α-helix	113-115	3
α-helix	119-121	3
β-strand	126-131	6	5
α-helix	132-140	9
α-helix	143-145	3
α-helix	153-155	3
β-strand	157-172	16	6
β-strand	176-196	21	6
α-helix	197-205	9
β-strand	213-218	6	5
β-strand	222-227	6	5
β-strand	230-235	6	5
α-helix	236-237	2
α-helix	241-243	3
α-helix	244-246	3
β-strand	254-259	6	6
α-helix	260-271	12
β-strand	280-286	7	1
β-strand	289-295	7	1
β-strand	301-307	7	1
β-strand	309	1	6
β-strand	315-320	6	1
α-helix	321-331	11
β-strand	335-340	6	6
β-strand	347-351	5	6
β-strand	357-361	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA polymerase III subunit beta	A, B	protein	366	Escherichia coli	P0A988 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4K3S_1 DNA polymerase III subunit beta (chains A, B)
MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALV
QPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLD
DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVC
SMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGR
FPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQE
EAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYV
VMPMRL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
P4C	O-acetaldehydyl-hexaethylene glycol	C14 H28 O8	1

Water and common crystallization additives (PG4) are not listed.

Primary citation

Structural and Thermodynamic Dissection of Linear Motif Recognition by the E. coli Sliding Clamp. Yin, Z., Kelso, M.J., Beck, J.L. et al. J Med Chem (2013) 56:8665-8673. DOI 10.1021/jm401118f · PubMed

Other PDB entries of the same protein (UniProt P0A988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PAY 1.21 Å, Structure of the E.coli DNA polymerase sliding clamp with a covalently bound peptide 2.
8PAT 1.45 Å, Structure of the E.coli DNA polymerase sliding clamp with a covalently bound peptide 3.
4K3L 1.5 Å, E. coli sliding clamp in complex with AcLF dipeptide
8CIY 1.54 Å, DNA-polymerase sliding clamp (DnaN) from Escherichia coli in complex with…
7AZ8 1.61 Å, DNA polymerase sliding clamp from Escherichia coli with peptide 43 bound
4MJR 1.62 Å, E. coli sliding clamp in complex with (S)-Carprofen
6FVM 1.63 Å, Mutant DNA polymerase sliding clamp from Escherichia coli with bound P7 peptide
3D1G 1.64 Å, Structure of a small molecule inhibitor bound to a DNA sliding clamp
1OK7 1.65 Å, A Conserved protein binding-site on Bacterial Sliding Clamps
7AZ7 1.65 Å, DNA polymerase sliding clamp from Escherichia coli with peptide 37 bound
4N96 1.7 Å, E. coli sliding clamp in complex with 6-nitroindazole
4N98 1.7 Å, E. coli sliding clamp in complex with 4'-fluorobiphenyl-4-carboxylic acid

Browse structure collections

About this viewer

MolViewer shows 4K3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.