Human cohesin inhibitor WapL. Determined by X-ray diffraction at 2.62 Å resolution. Released 19 Jun 2013.
Explore 4K6J in 3D Show helices and sheets RCSB PDB PDBe
4K6J contains 58 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -1-640 | 12 | |
| α-helix | 652-664 | 13 | |
| α-helix | 671-684 | 14 | |
| α-helix | 688-696 | 9 | |
| α-helix | 700-706 | 7 | |
| α-helix | 710-712 | 3 | |
| α-helix | 714-727 | 14 | |
| α-helix | 738-749 | 12 | |
| α-helix | 765-780 | 16 | |
| α-helix | 786-788 | 3 | |
| α-helix | 791-802 | 12 | |
| α-helix | 810-817 | 8 | |
| α-helix | 820-836 | 17 | |
| α-helix | 841-862 | 22 | |
| α-helix | 866-897 | 32 | |
| α-helix | 912-913 | 2 | |
| α-helix | 917-941 | 25 | |
| α-helix | 945-952 | 8 | |
| α-helix | 957-966 | 10 | |
| α-helix | 968-971 | 4 | |
| α-helix | 974-976 | 3 | |
| α-helix | 977-992 | 16 | |
| α-helix | 996-1003 | 8 | |
| β-strand | 1006-1007 | 2 | 1 |
| β-strand | 1030-1031 | 2 | 1 |
| α-helix | 1032-1058 | 27 | |
| α-helix | 1107-1135 | 29 | |
| α-helix | 1137-1146 | 10 | |
| α-helix | 1148-1150 | 3 | |
| α-helix | 1153-1169 | 17 | |
| α-helix | 1174-1188 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -1-639 | 11 | |
| α-helix | 652-655 | 4 | |
| α-helix | 657-663 | 7 | |
| α-helix | 671-684 | 14 | |
| α-helix | 688-696 | 9 | |
| α-helix | 700-706 | 7 | |
| α-helix | 710-712 | 3 | |
| α-helix | 714-727 | 14 | |
| α-helix | 738-748 | 11 | |
| α-helix | 763-780 | 18 | |
| α-helix | 786-788 | 3 | |
| α-helix | 791-802 | 12 | |
| α-helix | 810-818 | 9 | |
| α-helix | 820-835 | 16 | |
| α-helix | 841-861 | 21 | |
| α-helix | 866-894 | 29 | |
| α-helix | 895-897 | 3 | |
| α-helix | 922-941 | 20 | |
| α-helix | 945-952 | 8 | |
| α-helix | 957-966 | 10 | |
| α-helix | 969-971 | 3 | |
| α-helix | 974-992 | 19 | |
| α-helix | 996-1003 | 8 | |
| α-helix | 1032-1053 | 22 | |
| α-helix | 1109-1135 | 27 | |
| α-helix | 1137-1146 | 10 | |
| α-helix | 1148-1150 | 3 | |
| α-helix | 1153-1169 | 17 | |
| α-helix | 1174-1188 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Wings apart-like protein homolog | A, B | protein | 568 | Homo sapiens | Q7Z5K2 (AlphaFold model) |
>4K6J_1 Wings apart-like protein homolog (chains A, B) GPLGSGRPELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLA TKCAMPSFRMHLRAHGMVAMVFKTLDDSQHHQNLSLCTAALMYILSRDRLNMDLDRASLD LMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKHLDLENITTGHLAMETLLSL TSKRAGDWFKEELRLLGGLDHIVDKVKECVDHLSRDEDEEKLVASLWGAERCLRVLESVT VHNPENQSYLIAYKDSQLIVSSAKALQHCEELIQQYNRAEDSICLADSKPLPHQNVTNHV GKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQDGLIGTALNCVLQVPKYLPQEQRFDIRV LGLGLLINLVEYSARNRHCLVNMETSCSFDSSICSGEGDDSLRIGGQVHAVQALVQLFLE RERAAQLAESKTDELIKDAPTTQHDKSGEWQETSGEIQWVSTEKTDGTEEKHKKEEEDEE LDLNKALQHAGKHMEDCIVASYTALLLGCLCQESPINVTTVREYLPEGDFSIMTEMLKKF LSFMNLTCAVGTTGQKSISRVIEYLEHC
Structure of the human cohesin inhibitor Wapl. Ouyang, Z., Zheng, G., Song, J. et al. Proc Natl Acad Sci U S A (2013) 110:11355-11360. DOI 10.1073/pnas.1304594110 · PubMed
Other PDB entries of the same protein (UniProt Q7Z5K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4K6J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.