CK1d in complex with 9-[3-(4-fluorophenyl)-1-methyl-1H-pyrazol-4-yl]-2,3,4,5-tetrahydropyrido[2,3-f][1,4]oxazepine inhibitor. Determined by X-ray diffraction at 1.98 Å resolution. Released 18 Sept 2013.
Explore 4KBA in 3D Show helices and sheets RCSB PDB PDBe
4KBA contains 56 α-helices and 45 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 9-18 | 10 | 1 |
| β-strand | 21-28 | 8 | 1 |
| β-strand | 33-39 | 7 | 1 |
| α-helix | 49-59 | 11 | |
| β-strand | 68-74 | 7 | 1 |
| β-strand | 77-83 | 7 | 1 |
| β-strand | 88 | 1 | 2 |
| α-helix | 89-95 | 7 | |
| α-helix | 102-121 | 20 | |
| β-strand | 124-125 | 2 | 3 |
| α-helix | 131-133 | 3 | |
| β-strand | 134-136 | 3 | 2 |
| α-helix | 139-141 | 3 | |
| α-helix | 144 | 1 | |
| β-strand | 145-147 | 3 | 2 |
| β-strand | 154-155 | 2 | 3 |
| α-helix | 182-185 | 4 | |
| α-helix | 188-190 | 3 | |
| α-helix | 192-208 | 17 | |
| α-helix | 228-234 | 7 | |
| α-helix | 237-240 | 4 | |
| α-helix | 247-257 | 11 | |
| α-helix | 266-279 | 14 | |
| α-helix | 289-292 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 4 |
| β-strand | 9-16 | 8 | 4 |
| β-strand | 23-28 | 6 | 4 |
| β-strand | 33-40 | 8 | 4 |
| α-helix | 49-59 | 11 | |
| α-helix | 66-67 | 2 | |
| β-strand | 68-74 | 7 | 4 |
| β-strand | 77-83 | 7 | 4 |
| β-strand | 88 | 1 | 5 |
| α-helix | 89-95 | 7 | |
| α-helix | 102-121 | 20 | |
| β-strand | 124-125 | 2 | 6 |
| α-helix | 131-133 | 3 | |
| β-strand | 134-136 | 3 | 5 |
| α-helix | 139-141 | 3 | |
| β-strand | 145-147 | 3 | 5 |
| β-strand | 154-155 | 2 | 6 |
| β-strand | 157 | 1 | 7 |
| β-strand | 164 | 1 | 7 |
| α-helix | 165-167 | 3 | |
| α-helix | 182-185 | 4 | |
| α-helix | 188-190 | 3 | |
| α-helix | 192-208 | 17 | |
| α-helix | 221-234 | 14 | |
| α-helix | 237-240 | 4 | |
| α-helix | 247-257 | 11 | |
| α-helix | 266-279 | 14 | |
| α-helix | 289-292 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-17 | 9 | 8 |
| β-strand | 22-28 | 7 | 8 |
| β-strand | 33-39 | 7 | 8 |
| α-helix | 49-59 | 11 | |
| β-strand | 68-74 | 7 | 8 |
| β-strand | 77-83 | 7 | 8 |
| β-strand | 88 | 1 | 9 |
| α-helix | 89-95 | 7 | |
| α-helix | 102-121 | 20 | |
| β-strand | 124-125 | 2 | 10 |
| α-helix | 131-133 | 3 | |
| β-strand | 134-136 | 3 | 9 |
| α-helix | 139-141 | 3 | |
| β-strand | 145-147 | 3 | 9 |
| β-strand | 154-155 | 2 | 10 |
| α-helix | 182-185 | 4 | |
| α-helix | 188-190 | 3 | |
| α-helix | 192-208 | 17 | |
| α-helix | 221-234 | 14 | |
| α-helix | 237-240 | 4 | |
| α-helix | 247-257 | 11 | |
| α-helix | 266-279 | 14 | |
| α-helix | 289-292 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 11 |
| β-strand | 9-14 | 6 | 11 |
| β-strand | 23-28 | 6 | 11 |
| β-strand | 33-40 | 8 | 11 |
| α-helix | 49-59 | 11 | |
| β-strand | 68-73 | 6 | 11 |
| β-strand | 78-83 | 6 | 11 |
| β-strand | 88 | 1 | 12 |
| α-helix | 89-95 | 7 | |
| α-helix | 102-121 | 20 | |
| β-strand | 124-125 | 2 | 13 |
| α-helix | 131-133 | 3 | |
| β-strand | 134-136 | 3 | 12 |
| α-helix | 139-141 | 3 | |
| β-strand | 145-147 | 3 | 12 |
| β-strand | 154-155 | 2 | 13 |
| α-helix | 165-167 | 3 | |
| α-helix | 182-185 | 4 | |
| α-helix | 188-190 | 3 | |
| α-helix | 192-208 | 17 | |
| α-helix | 221-234 | 14 | |
| α-helix | 237-240 | 4 | |
| α-helix | 247-257 | 11 | |
| α-helix | 266-279 | 14 | |
| α-helix | 289-292 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Casein kinase I isoform delta | A, B, C, D | protein | 331 | Homo sapiens | P48730 (AlphaFold model) |
>4KBA_1 Casein kinase I isoform delta (chains A, B, C, D) MHHHHHHSSGLVPRGSLRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKH PQLHIESKIYKMMQGGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVL LLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIP YRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYE RISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDY VFDWNMLKFGASRAADDAERERRDREERLRH
| ID | Name | Formula | Copies |
|---|---|---|---|
| 1QM | 9-[3-(4-fluorophenyl)-1-methyl-1H-pyrazol-4-yl]-2,3,4,5-tetrahydropyrido[2,3-f]… | C18 H17 F N4 O | 4 |
Water and common crystallization additives (SO4) are not listed.
Ligand-protein interactions of selective casein kinase 1 delta inhibitors. Mente, S., Arnold, E., Butler, T. et al. J Med Chem (2013) 56:6819-6828. DOI 10.1021/jm4006324 · PubMed
Other PDB entries of the same protein (UniProt P48730 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4KBA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.