4KHB: Spt16D Pob3N heterodimer

Structure of the Spt16D Pob3N heterodimer. Determined by X-ray diffraction at 2.4 Å resolution. Released 29 May 2013.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Chaetomium thermophilum var. thermophilum
Chains: 8
Atoms: 9,291
Mol. weight: 147.08 kDa
Released: 29 May 2013

Explore 4KHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KHB contains 44 α-helices and 90 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	535-537	3
α-helix	540-544	5
β-strand	548-550	3	1
α-helix	551-553	3
β-strand	555-560	6	1
β-strand	563-568	6	1
α-helix	569-571	3
β-strand	572-580	9	2
β-strand	583-590	8	2
β-strand	611-620	10	2
α-helix	623-641	19

Chain B: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	19
β-strand	11-12	2	20
β-strand	19-24	6	19
β-strand	27-32	6	19
β-strand	39-42	4	19
α-helix	43-45	3
β-strand	48-53	6	20
β-strand	58-63	6	20
α-helix	64	1
β-strand	69-75	7	20
α-helix	77-79	3
α-helix	80-89	10
β-strand	95-97	3	20
α-helix	99-101	3
β-strand	107-108	2	2
β-strand	109-112	4	21
β-strand	116-121	6	21
β-strand	124-130	7	21
α-helix	131-133	3
β-strand	134-141	8	2
β-strand	144-149	6	2
β-strand	173-180	8	2

Chain C: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	535-537	3
α-helix	540-544	5
β-strand	548-550	3	18
α-helix	551-553	3
β-strand	555-560	6	18
β-strand	563-568	6	18
α-helix	569-571	3
β-strand	572-580	9	5
β-strand	583-590	8	5
β-strand	611-620	10	5
α-helix	623-638	16

Chains D and H: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	3
β-strand	11-12	2	4
β-strand	19-24	6	3
β-strand	27-31	5	3
β-strand	39-42	4	3
α-helix	43-45	3
β-strand	46-53	8	4
β-strand	58-64	7	4
β-strand	69-75	7	4
α-helix	77-79	3
α-helix	80-89	10
β-strand	95-97	3	4
α-helix	99-101	3
β-strand	107-108	2	5
β-strand	109-112	4	6
β-strand	116-121	6	6
β-strand	124-130	7	6
α-helix	131-133	3
β-strand	134-139	6	5
β-strand	144-149	6	5
β-strand	174-181	8	5

Chain E: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	535-537	3
α-helix	540-544	5
β-strand	548-550	3	16
α-helix	551-553	3
β-strand	555-560	6	16
β-strand	563-568	6	16
α-helix	569-571	3
β-strand	572-580	9	9
β-strand	583-590	8	9
β-strand	592	1	17
β-strand	595	1	17
β-strand	611-620	10	9
α-helix	623-637	15

Chain F: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
β-strand	5-10	6	7
β-strand	12	1	8
β-strand	19-24	6	7
β-strand	27-32	6	7
β-strand	39-42	4	7
α-helix	43-45	3
β-strand	48-53	6	8
β-strand	58-63	6	8
α-helix	64	1
β-strand	69-75	7	8
α-helix	77-79	3
α-helix	80-89	10
β-strand	95-97	3	8
α-helix	99-101	3
β-strand	107-108	2	9
β-strand	109-112	4	10
β-strand	116-121	6	10
β-strand	124-130	7	10
α-helix	131-133	3
β-strand	134-139	6	9
β-strand	145-149	5	9
β-strand	174-181	8	9

Chain G: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	535-537	3
α-helix	540-544	5
β-strand	548-550	3	15
α-helix	551-553	3
β-strand	555-560	6	15
β-strand	563-568	6	15
α-helix	569-571	3
β-strand	572-580	9	13
β-strand	583-590	8	13
α-helix	591	1
β-strand	611-620	10	13
α-helix	623-639	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein SPT16D	A, C, E, G	protein	127	Chaetomium thermophilum var. thermophilum	G0SDN1 (AlphaFold model)
Uncharacterized protein POB3N	B, D, F, H	protein	195	Chaetomium thermophilum var. thermophilum	G0SHK5 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>4KHB_1 Uncharacterized protein SPT16D (chains A, C, E, G)
MEVKKFKRFESYKRDNQLPPKVRDMGIVIDQKNNTIVLPIMGRPVPFHINTIKNASKSDE
GEWSFLRINFLSPGQGVGRKDDQPFEDASAHFVRSLTFRSTDGDRYAEIANQISNLKREA
VKREQEK

Sequence of entity 2 (B, D, F, H), FASTA

>4KHB_2 Uncharacterized protein POB3N (chains B, D, F, H)
GSHMAAIESFDHIYLDLSKEPGKCRFAENGLGWKPVGGGETFTLDVSNIGGAQWSRAARG
YEVKILQRTSGVIQLDGFQQEDYERLAKIFKNWYSTNLENKEHSLRGWNWGKAEFGKAEL
TFNVQNRPAFEIPYSEIANTNLAGRNEIAVEFAPGDHGKSSQNGQVKSKKASASRDQLVE
IRFYIPGTTTRKEAE

Primary citation

Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele, M., Stuwe, T., Hassler, M. et al. Nature (2013) 499:111-114. DOI 10.1038/nature12242 · PubMed

Other PDB entries of the same protein (UniProt G0SDN1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4KHO 2.0 Å, Structure of the FACT complex Subunit Spt16M
4KHA 2.35 Å, Structural basis of histone H2A-H2B recognition by the essential chaperone FACT

Browse structure collections

About this viewer

MolViewer shows 4KHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.