4KHO: FACT complex Subunit Spt16M

Structure of the FACT complex Subunit Spt16M. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 May 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Chaetomium thermophilum var. thermophilum
Chains: 2
Atoms: 4,782
Mol. weight: 69.86 kDa
Ligands: CA
Released: 29 May 2013

Explore 4KHO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KHO contains 27 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	657-661	5
α-helix	666-668	3
β-strand	669-673	5	1
β-strand	674-676	3	2
β-strand	686-690	5	1
β-strand	694-699	6	1
β-strand	702-710	9	1
α-helix	711-713	3
β-strand	714-720	7	2
β-strand	727-740	14	2
β-strand	743-753	11	2
α-helix	778-806	29
α-helix	808-810	3
β-strand	814-815	2	2
α-helix	819-821	3
β-strand	823-825	3	3
β-strand	826	1	4
β-strand	832-834	3	3
β-strand	835-836	2	5
β-strand	840-843	4	5
α-helix	849	1
β-strand	850-853	4	5
α-helix	854-856	3
β-strand	857-863	7	6
β-strand	871-878	8	6
α-helix	884-885	2
β-strand	886-892	7	6
α-helix	893-895	3
α-helix	896-905	10
β-strand	910-913	4	6
α-helix	919-928	10
α-helix	930-935	6
α-helix	938-942	5

Chain B: 13 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	657-659	3
β-strand	669-673	5	7
β-strand	674-676	3	8
α-helix	678-679	2
β-strand	686-690	5	7
β-strand	694-699	6	7
β-strand	702-710	9	7
α-helix	711-713	3
β-strand	714-720	7	8
β-strand	728-740	13	8
β-strand	743-752	10	8
α-helix	782-806	25
β-strand	814-815	2	8
α-helix	819-821	3
β-strand	823-825	3	9
β-strand	826	1	10
β-strand	832-834	3	9
β-strand	835-836	2	11
β-strand	840-843	4	11
α-helix	849	1
β-strand	850-853	4	11
α-helix	854-856	3
β-strand	857-863	7	12
β-strand	871-878	8	12
α-helix	884-885	2
β-strand	886-892	7	12
α-helix	893-895	3
α-helix	896-905	10
β-strand	910-913	4	12
α-helix	919-928	10
α-helix	930-935	6
α-helix	938-942	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein Spt16M	A, B	protein	299	Chaetomium thermophilum var. thermophilum	G0SDN1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4KHO_1 Uncharacterized protein Spt16M (chains A, B)
GSHMEDVVEQDKLIEIRNRRPAVLDNVYIRPALEGKRVPGKVEIHQNGIRYQSPLSTTQR
VDVLFSNIRHLFFQPCQNEMIVIIHLHLKDPILFGKKKTKDVQFYREAIDIQFDETGNRK
RKYRYGDEDEFEAEQEERRRKAELDRLFKSFAEKIAEAGRNEGIEVDMPIRDLGFNGVPN
RSNVVIYPTTECLIQITEPPFLVITLEDVEWAHLERVQFGLKNFDLVFVFKDFTRPVVHI
NTIPVESLEDVKEFLDSSDIPFSEGPLNLNWSVIMKTVTANPHQFFLDGGWGFLQNDSD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Structural basis of histone H2A-H2B recognition by the essential chaperone FACT. Hondele, M., Stuwe, T., Hassler, M. et al. Nature (2013) 499:111-114. DOI 10.1038/nature12242 · PubMed

Other PDB entries of the same protein (UniProt G0SDN1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4KHA 2.35 Å, Structural basis of histone H2A-H2B recognition by the essential chaperone FACT
4KHB 2.4 Å, Structure of the Spt16D Pob3N heterodimer

Browse structure collections

About this viewer

MolViewer shows 4KHO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.