4KZN: Human VEGF-A receptor binding domain

crystal structure of human VEGF-A receptor binding domain. Determined by X-ray diffraction at 1.71 Å resolution. Released 4 Jun 2014.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Homo sapiens
Chains: 1
Atoms: 927
Mol. weight: 13.59 kDa
Released: 4 Jun 2014

Explore 4KZN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KZN contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
α-helix	17-24	8
β-strand	25	1	1
β-strand	27-34	8	2
α-helix	35-38	4
β-strand	46-48	3	3
β-strand	51-58	8	2
β-strand	60	1	1
β-strand	66-84	19	3
β-strand	88-106	19	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vascular endothelial growth factor A	A	protein	104	Homo sapiens	P15692 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4KZN_1 Vascular endothelial growth factor A (chains A)
SHHHHHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEG
LECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD

Primary citation

Structural Basis for the Bivalent Glycosylated Human VEGF-A121 and VEGF-A165 in recruiment of Receptor and Co-receptor. Shen, S.T., Huang, P.T., Shuau, Y.S. et al. To be published.

Other PDB entries of the same protein (UniProt P15692 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MKK 1.32 Å, Disulfide deficient mutant of vascular endothelial growth factor A (C61A and C104A)
9JU1 1.45 Å, Helix-loop-helix peptide (VS42-LR3) in complex with VEGF-A
9KKU 1.46 Å, Helix-loop-helix peptide (M49) in complex with VEGF-A
4GLN 1.6 Å, Crystal Structure of Chemically Synthesized Heterochiral {D-Protein Antagonist plus…
4GLS 1.6 Å, Crystal Structure of Chemically Synthesized Heterochiral {D-Protein Antagonist plus…
6ZBR 1.6 Å, VEGF-A 13:107 crystallized with 4C bicyclic peptide
6ZFL 1.6 Å, High resolution structure of VEGF-A 12:107 crystallized in tetragonal form
1FLT 1.7 Å, Vegf in complex with domain 2 of the flt-1 receptor
4QAF 1.8 Å, Crystal structure of an engineered lipocalin (Anticalin) in complex with VEGF(8-109)
6Z13 1.8 Å, VEGF-A 13:107 crystallized with 3C bicyclic peptide
6ZCD 1.8 Å, VEGF-A 13:107 crystallized with 1C bicyclic peptide
3QTK 1.85 Å, The crystal structure of chemically synthesized VEGF-A

Browse structure collections

About this viewer

MolViewer shows 4KZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.