4L00: Apo Jak1 pseudokinase domain

Crystal structure of the apo Jak1 pseudokinase domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Sept 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,931
Mol. weight: 69.84 kDa
Released: 4 Sept 2013

Explore 4L00 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4L00 contains 39 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	569-572	4
α-helix	580-582	3
β-strand	583-592	10	1
β-strand	595-603	9	1
β-strand	616-624	9	1
α-helix	625	1
α-helix	629-644	16
β-strand	650	1	2
β-strand	653-659	7	1
β-strand	662-668	7	1
β-strand	674	1	2
α-helix	675-682	8
α-helix	688-707	20
α-helix	717-719	3
β-strand	720-724	5	2
β-strand	734-737	4	2
α-helix	744-746	3
α-helix	749-754	6
α-helix	761-765	5
α-helix	767-769	3
α-helix	774-787	14
α-helix	791-792	2
α-helix	799-807	9
α-helix	812-815	4
α-helix	818-827	10
α-helix	832-834	3
α-helix	836-837	2
α-helix	838-848	11

Chain B: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	569-573	5
α-helix	574-576	3
β-strand	577-578	2	3
α-helix	580-582	3
β-strand	583-592	10	3
β-strand	595-603	9	3
β-strand	616-624	9	3
α-helix	626-631	6
α-helix	632-644	13
β-strand	650	1	4
β-strand	653-658	6	3
β-strand	663-668	6	3
β-strand	674	1	4
α-helix	675-682	8
α-helix	688-707	20
α-helix	717-719	3
β-strand	720-724	5	4
β-strand	734-737	4	4
α-helix	744-746	3
α-helix	749-754	6
α-helix	761-765	5
α-helix	767-769	3
α-helix	773-787	15
α-helix	791-792	2
α-helix	799-807	9
α-helix	813-815	3
α-helix	818-827	10
α-helix	832-834	3
α-helix	836-837	2
α-helix	838-849	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase JAK1	A, B	protein	304	Homo sapiens	P23458 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4L00_1 Tyrosine-protein kinase JAK1 (chains A, B)
GSTSAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKK
IKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLD
LFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIK
LSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKD
KTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIV
SEKK

Primary citation

Structure of a pseudokinase-domain switch that controls oncogenic activation of Jak kinases. Toms, A.V., Deshpande, A., McNally, R. et al. Nat Struct Mol Biol (2013) 20:1221-1223. DOI 10.1038/nsmb.2673 · PubMed

Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N7A 1.33 Å, Structure of the human JAK1 kinase domain with compound 39
10PI 1.54 Å, JAK1 kinase (JH1 domain) in complex with povorcitinib
6N77 1.64 Å, Structure of the human JAK1 kinase domain with compound 15
6N7C 1.69 Å, Structure of the human JAK1 kinase domain with compound 56
6GGH 1.7 Å, Human jak1 kinase domain in complex with inhibitor
6RSH 1.71 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
8S85 1.75 Å, Crystal structure of JAK1 JH1 domain in complex with an inhibitor
6RSD 1.76 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
6N7D 1.78 Å, Structure of the human JAK1 kinase domain with compound 54
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
6ELR 1.8 Å, Human jak1 kinase domain in complex with compound 7
6RSB 1.8 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…

Browse structure collections

About this viewer

MolViewer shows 4L00 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.