4L23: P110alpha

Crystal Structure of p110alpha complexed with niSH2 of p85alpha and PI-103. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Jan 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,928
Mol. weight: 164.13 kDa
Ligands: X6K
Released: 1 Jan 2014

Explore 4L23 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4L23 contains 71 α-helices and 53 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 61 helices, 45 β-strands

Element	Residues	Length	Sheet
β-strand	19-21	3	1
β-strand	23-25	3	2
β-strand	31-32	2	2
β-strand	35-37	3	1
β-strand	41	1	3
α-helix	42-53	12
α-helix	65-67	3
β-strand	69-73	5	2
β-strand	74	1	4
β-strand	79-82	4	2
β-strand	88	1	3
α-helix	89-91	3
β-strand	94	1	4
β-strand	98-102	5	2
α-helix	108-121	14
α-helix	126-130	5
α-helix	134-142	9
α-helix	144-153	10
α-helix	160-166	7
β-strand	171	1	5
α-helix	176-178	3
α-helix	179-182	4
β-strand	186	1	6
β-strand	189-197	9	6
β-strand	204-212	9	6
α-helix	217-226	10
α-helix	240-245	6
β-strand	250-254	5	6
β-strand	260-261	2	6
α-helix	267-269	3
β-strand	270	1	5
α-helix	271-278	8
α-helix	281-283	3
β-strand	284-289	6	6
α-helix	290-294	5
α-helix	324	1
β-strand	325-326	2	7
α-helix	327-329	3
β-strand	333-341	9	8
β-strand	353-362	10	9
β-strand	365-366	2	9
α-helix	372-375	4
β-strand	376	1	9
β-strand	382-392	11	8
α-helix	393-395	3
β-strand	401-409	9	9
β-strand	419-428	10	9
β-strand	430	1	10
β-strand	435	1	7
β-strand	436	1	10
α-helix	437	1
β-strand	439-444	6	8
α-helix	445	1
β-strand	446	1	9
α-helix	447-449	3
α-helix	461-462	2
β-strand	472-477	6	8
β-strand	484-485	2	7
α-helix	486-488	3
α-helix	489-502	14
α-helix	517-520	4
α-helix	525-534	10
α-helix	542-544	3
α-helix	545-553	9
α-helix	558-560	3
α-helix	562-564	3
α-helix	565-571	7
α-helix	577-589	13
α-helix	590-592	3
α-helix	595-598	4
α-helix	599-602	4
α-helix	609-622	14
α-helix	625-638	14
α-helix	648-659	12
α-helix	661-672	12
α-helix	681-694	14
α-helix	698-721	24
α-helix	728-739	12
α-helix	742-748	7
β-strand	751-752	2	11
β-strand	760-761	2	11
β-strand	764	1	12
α-helix	766-768	3
β-strand	770-771	2	12
β-strand	779-784	6	12
α-helix	790-792	3
β-strand	796-803	8	12
α-helix	808-825	18
β-strand	838-842	5	12
β-strand	845-849	5	12
α-helix	850-851	2
β-strand	854-856	3	13
α-helix	857-861	5
α-helix	876-885	10
α-helix	890-911	22
α-helix	913	1
α-helix	915-916	2
β-strand	921-924	4	13
β-strand	929-931	3	13
α-helix	949-951	3
α-helix	958-964	7
α-helix	975-993	19
α-helix	995-1003	9
α-helix	1016-1019	4
α-helix	1021-1025	5
α-helix	1032-1046	15

Chain B: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	323-325	3
α-helix	328-330	3
β-strand	334	1	14
α-helix	340-347	8
β-strand	354-359	6	14
α-helix	360-361	2
β-strand	368-374	7	14
β-strand	377-383	7	14
β-strand	384-386	3	15
β-strand	389-391	3	15
α-helix	396	1
β-strand	398	1	15
α-helix	401-410	10
β-strand	426-427	2	14
α-helix	432-436	5
α-helix	442-512	71
α-helix	521-585	65
α-helix	591-597	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	A	protein	1068	Homo sapiens	P42336 (AlphaFold model)
Phosphatidylinositol 3-kinase regulatory subunit alpha	B	protein	324	Homo sapiens	P27986 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4L23_1 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (chains A)
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN

Sequence of entity 2 (B), FASTA

>4L23_2 Phosphatidylinositol 3-kinase regulatory subunit alpha (chains B)
MSYYHHHHHHDYDIPTTENLYFQSIAANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTA
DGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNE
SLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYT
RTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKL
KSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQ
KKLNEWLGNENTEDQYSLVEDDED

Ligands and cofactors

ID	Name	Formula	Copies
X6K	3-(4-morpholin-4-YLPYRIDO[3',2':4,5]FURO[3,2-d]pyrimidin-2-yl)phenol	C19 H16 N4 O3	1

Water and common crystallization additives (GOL, SO4) are not listed.

Primary citation

Crystal Structures of PI3K alpha Complexed with PI103 and Its Derivatives: New Directions for Inhibitors Design. Zhao, Y., Zhang, X., Chen, Y. et al. ACS Med Chem Lett (2014) 5:138-142. DOI 10.1021/ml400378e · PubMed

Other PDB entries of the same protein (UniProt P42336 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CMK 1.75 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASF 1.77 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide analogue…
9CX0 1.92 Å, Crystal structure of HLA-A*03:01 E152V mutant in complex with a mutant PIK3CA peptide
7L1C 1.96 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide
9CWY 1.98 Å, Crystal structure of HLA-A*03:02 in complex with a wild-type PIK3CA peptide
8EXL 1.99 Å, Crystal structure of PI3K-alpha in complex with taselisib
9CX1 2.0 Å, Crystal structure of HLA-A*03:01 L156Q mutant in complex with a mutant PIK3CA peptide
9CML 2.01 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASG 2.03 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide analogue (Trp-6…
7L1B 2.04 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide
9CWZ 2.05 Å, Crystal structure of HLA-A*03:02 in complex with a mutant PIK3CA peptide
7JIU 2.12 Å, Human PI3KDELTA in complex with compound 2F

Browse structure collections

About this viewer

MolViewer shows 4L23 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.