4LHW: Rab8 in its active GppNHp-bound form

Crystal structure of Rab8 in its active GppNHp-bound form. Determined by X-ray diffraction at 1.55 Å resolution. Released 9 Oct 2013.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 5
Atoms: 8,195
Mol. weight: 102.69 kDa
Ligands: GNP, MG
Released: 9 Oct 2013

Explore 4LHW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LHW contains 43 α-helices and 42 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	21-30	10
β-strand	38	1	2
β-strand	43-52	10	1
β-strand	55-64	10	1
α-helix	73-78	6
β-strand	83-89	7	1
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	1
α-helix	126-128	3
α-helix	133-143	11
β-strand	146-149	4	1
β-strand	151	1	3
β-strand	156	1	3
α-helix	158-174	17

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	4
α-helix	21-30	10
β-strand	43-52	10	4
β-strand	55-64	10	4
α-helix	68-70	3
α-helix	71-76	6
β-strand	83-89	7	4
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	4
α-helix	126-128	3
α-helix	133-143	11
β-strand	146-149	4	4
β-strand	151	1	5
β-strand	156	1	5
α-helix	158-174	17

Chain C: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-15	9	6
α-helix	21-30	10
β-strand	34	1	2
α-helix	37-40	4
β-strand	43-52	10	6
β-strand	55-64	10	6
α-helix	68-70	3
α-helix	71-74	4
α-helix	75-77	3
β-strand	83-89	7	6
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	6
α-helix	126-128	3
α-helix	133-143	11
β-strand	146-149	4	6
β-strand	151	1	7
β-strand	156	1	7
α-helix	158-175	18

Chain D: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	8
α-helix	21-30	10
α-helix	37-40	4
β-strand	43-52	10	8
β-strand	55-64	10	8
α-helix	68-70	3
α-helix	71-75	5
β-strand	83-89	7	8
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	8
α-helix	126-128	3
α-helix	133-143	11
β-strand	146-149	4	8
β-strand	151	1	9
β-strand	156	1	9
α-helix	158-173	16

Chain E: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	10
α-helix	21-30	10
β-strand	43-52	10	10
β-strand	55-64	10	10
α-helix	68-70	3
α-helix	71-74	4
α-helix	75-77	3
β-strand	83-89	7	10
α-helix	93-97	5
α-helix	99-108	10
β-strand	115-121	7	10
α-helix	126-128	3
α-helix	133-143	11
β-strand	146-149	4	10
β-strand	151	1	11
β-strand	156	1	11
α-helix	158-175	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-8A	A, B, C, D, E	protein	174	Homo sapiens	P61006 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>4LHW_1 Ras-related protein Rab-8A (chains A, B, C, D, E)
GSHDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIW
DTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNK
CDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	5
MG	Magnesium ion	Mg	5

Water and common crystallization additives (MPD) are not listed.

Primary citation

Intermediates in the Guanine Nucleotide Exchange Reaction of Rab8 Protein Catalyzed by Guanine Nucleotide Exchange Factors Rabin8 and GRAB. Guo, Z., Hou, X., Goody, R.S. et al. J Biol Chem (2013) 288:32466-32474. DOI 10.1074/jbc.M113.498329 · PubMed

Other PDB entries of the same protein (UniProt P61006 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SQ2 1.68 Å, Structure of a phosphomimetic switch 2 variant of Rab8a in complex with the phospho-Rab…
6WHE 1.73 Å, Structure of phosphomimetic Rab8a GTPase (T72E) in the GTP-bound state
6RIR 1.77 Å, Crystal structure of phosphorylated Rab8a in complex with the Rab-binding domain of RILPL2
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
7LWB 1.9 Å, Crystal Structure of phospho-Rab8a with the RH2 domain (117-165) of RILPL2
6ZSI 1.91 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
4LHV 1.95 Å, Crystal structure of Rab8 in its inactive GDP-bound form
3QBT 2.0 Å, Crystal structure of OCRL1 540-678 in complex with Rab8a:GppNHp
6ZSJ 2.0 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
6YX5 2.14 Å, Structure of DrrA from Legionella pneumophilia in complex with human Rab8a
7BWT 2.3 Å, SopD-Rab8 complex structure

Browse structure collections

About this viewer

MolViewer shows 4LHW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.