4LI1: Lgr4 and its complex with R-spondin1

Crystal Structures of Lgr4 and its complex with R-spondin1. Determined by X-ray diffraction at 2.66 Å resolution. Released 7 Aug 2013.

Method: X-ray diffraction
Resolution: 2.66 Å
Organism: Xenopus (Silurana) tropicalis
Chains: 2
Atoms: 6,803
Mol. weight: 95.56 kDa
Ligands: NAG
Released: 7 Aug 2013

Explore 4LI1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LI1 contains 11 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	38	1	6
β-strand	43-45	3	6
β-strand	64-66	3	6
β-strand	74-75	2	7
β-strand	88-90	3	6
β-strand	98-99	2	7
β-strand	112-114	3	6
β-strand	122	1	8
β-strand	136-138	3	6
β-strand	146	1	8
β-strand	160-162	3	6
α-helix	173-176	4
β-strand	184-186	3	6
β-strand	194-195	2	9
β-strand	208-210	3	6
β-strand	218-219	2	9
β-strand	232-234	3	6
α-helix	245-249	5
β-strand	255-257	3	6
β-strand	265-266	2	10
β-strand	279-281	3	6
β-strand	289-290	2	10
β-strand	303-307	5	6
β-strand	326-330	5	6
α-helix	340-344	5
β-strand	350-352	3	6
β-strand	372-374	3	6
β-strand	382-383	2	11
α-helix	386-388	3
β-strand	396-398	3	6
β-strand	406-407	2	11
α-helix	411-414	4
β-strand	420-422	3	6
β-strand	441-443	3	6
α-helix	450-453	4

Chain B: 5 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	37-38	2	1
β-strand	43-45	3	1
α-helix	54-55	2
β-strand	64-66	3	1
β-strand	88-90	3	1
β-strand	112-114	3	1
β-strand	122	1	2
β-strand	136-138	3	1
β-strand	146	1	2
β-strand	160-162	3	1
α-helix	173-176	4
β-strand	184-186	3	1
β-strand	194-195	2	3
β-strand	208-210	3	1
β-strand	218-219	2	3
β-strand	232-234	3	1
α-helix	245-249	5
β-strand	255-257	3	1
β-strand	265-266	2	4
β-strand	279-281	3	1
β-strand	289-290	2	4
β-strand	303-307	5	1
β-strand	326-330	5	1
α-helix	340-344	5
β-strand	350-352	3	1
β-strand	372-374	3	1
β-strand	382-383	2	5
β-strand	396-398	3	1
β-strand	406-407	2	5
β-strand	420-422	3	1
β-strand	441-443	3	1
α-helix	451-453	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing G-protein coupled receptor 4	A, B	protein	432	Xenopus (Silurana) tropicalis	B0BLW3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LI1_1 Leucine-rich repeat-containing G-protein coupled receptor 4 (chains A, B)
SGVSSPAPCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGF
PYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANH
IVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNL
SSLVVLHLHNNKIRTLGPHCFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSI
TIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNN
LESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEV
QNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLK
LTGNPNFKETLT

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structures of lgr4 and its complex with R-spondin1. Xu, K., Xu, Y., Rajashankar, K.R. et al. Structure (2013) 21:1683-1689. DOI 10.1016/j.str.2013.07.001 · PubMed

Other PDB entries of the same protein (UniProt B0BLW3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LI2 3.19 Å, Crystal Structures of Lgr4 and its complex with R-spondin1

Browse structure collections

About this viewer

MolViewer shows 4LI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.