4LLU: Pertuzumab Fab with light chain Clambda

Structure of Pertuzumab Fab with light chain Clambda at 2.16A. Determined by X-ray diffraction at 2.16 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 2.16 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,706
Mol. weight: 94.84 kDa
Released: 29 Jan 2014

Explore 4LLU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LLU contains 34 α-helices and 90 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-39	7	2
β-strand	45-51	7	2
β-strand	57-59	3	2
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-96	9	2
β-strand	99-103	7	2
β-strand	107-111	5	2
β-strand	117	1	3
α-helix	118-119	2
β-strand	120-127	8	4
β-strand	131	1	5
β-strand	136-145	10	4
β-strand	146	1	3
β-strand	151-154	4	6
α-helix	155-157	3
β-strand	159	1	6
β-strand	163-165	3	4
α-helix	166-168	3
β-strand	169-170	2	4
β-strand	176-184	9	4
β-strand	195-200	6	6
α-helix	201-203	3
β-strand	205-210	6	6

Chain B: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-90	7	8
α-helix	97	1
β-strand	98	1	8
α-helix	99	1
β-strand	102-106	5	8
α-helix	109-111	3
β-strand	112	1	9
α-helix	113-114	2
β-strand	115-119	5	5
α-helix	120-122	3
α-helix	123-127	5
β-strand	131-140	10	5
β-strand	141	1	9
β-strand	146-151	6	10
β-strand	154-156	3	10
β-strand	160-162	3	5
α-helix	163-165	3
β-strand	166-167	2	5
β-strand	173-181	9	5
α-helix	183-187	5
β-strand	192-198	7	10
β-strand	201-207	7	10

Chain C: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	11
β-strand	10-12	3	12
β-strand	18-25	8	11
α-helix	29-31	3
β-strand	33-39	7	12
β-strand	45-51	7	12
β-strand	57-59	3	12
β-strand	68-72	5	11
β-strand	77-82	6	11
α-helix	84-86	3
β-strand	88-96	9	12
β-strand	99-103	7	12
β-strand	107-111	5	12
α-helix	115-116	2
β-strand	117	1	13
α-helix	118-119	2
β-strand	120-124	5	14
α-helix	128-130	3
β-strand	131-132	2	14
β-strand	135-145	11	14
β-strand	146	1	13
β-strand	151-154	4	15
α-helix	155-157	3
β-strand	159	1	15
β-strand	163-165	3	14
α-helix	166-168	3
β-strand	169-170	2	14
β-strand	176-185	10	14
β-strand	194-200	7	15
α-helix	201-203	3
β-strand	205-211	7	15

Chain D: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	16
β-strand	10-11	2	17
β-strand	19-25	7	16
β-strand	33-38	6	17
β-strand	45-49	5	17
β-strand	53-54	2	17
α-helix	55	1
β-strand	62-67	6	16
β-strand	70-75	6	16
β-strand	85-90	6	17
α-helix	97	1
β-strand	98	1	17
α-helix	99	1
β-strand	102-104	3	17
β-strand	112	1	18
α-helix	113-114	2
β-strand	115-119	5	19
α-helix	120-122	3
α-helix	123-127	5
β-strand	131-140	10	19
β-strand	141	1	18
β-strand	146-151	6	20
β-strand	154-155	2	20
α-helix	156	1
β-strand	160-162	3	19
α-helix	163-165	3
β-strand	166-167	2	19
β-strand	173-181	9	19
α-helix	183-188	6
β-strand	192-198	7	20
β-strand	201-207	7	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PERTUZUMAB FAB Heavy chain	A, C	protein	227	Homo sapiens	S6C4R2 (AlphaFold model)
Light chain CLAMBDA	B, D	protein	212	Homo sapiens	P0DOY2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4LLU_1 PERTUZUMAB FAB Heavy chain (chains A, C)
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIY
NQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 2 (B, D), FASTA

>4LLU_2 Light chain CLAMBDA (chains B, D)
DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKGQPKAAPSVTLFP
PSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLS
LTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC

Primary citation

Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface. Lewis, S.M., Wu, X., Pustilnik, A. et al. Nat Biotechnol (2014) 32:191-198. DOI 10.1038/nbt.2797 · PubMed

Other PDB entries of the same protein (UniProt S6C4R2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PUB 1.75 Å, Crystal structure of Fab DX-2930
4OGY 2.1 Å, Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.1 Angstrom…
4OGX 2.4 Å, Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.4 Angstrom…
5W1K 3.99 Å, JUNV GP1 CR1-10 Fab CR1-28 Fab complex

Browse structure collections

About this viewer

MolViewer shows 4LLU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.