4LOT: C1s CUB2-CCP1-CCP2

C1s CUB2-CCP1-CCP2. Determined by X-ray diffraction at 2.92 Å resolution. Released 7 Aug 2013.

Method: X-ray diffraction
Resolution: 2.92 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,908
Mol. weight: 27.51 kDa
Released: 7 Aug 2013

Explore 4LOT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LOT contains 6 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	164-165	2	1
β-strand	169-173	5	2
α-helix	180-181	2
β-strand	186-192	7	1
β-strand	197-208	12	2
β-strand	209	1	3
β-strand	222-227	6	1
β-strand	230-235	6	1
β-strand	238	1	3
β-strand	245-247	3	2
β-strand	252-258	7	1
β-strand	268-276	9	2
α-helix	277	1
β-strand	278	1	4
α-helix	281-283	3
β-strand	287-290	4	5
β-strand	297	1	4
β-strand	301-306	6	5
β-strand	310-312	3	6
β-strand	321-325	5	5
β-strand	326	1	7
β-strand	332	1	7
β-strand	339-341	3	6
α-helix	342	1
β-strand	343	1	8
α-helix	347-348	2
β-strand	353-355	3	9
β-strand	362	1	8
β-strand	366-368	3	10
β-strand	369-371	3	9
β-strand	377	1	11
β-strand	385-389	5	10
β-strand	393-395	3	10
β-strand	396	1	12
β-strand	400	1	12
α-helix	403-404	2
β-strand	407	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C1s subcomponent heavy chain	A	protein	249	Homo sapiens	P09871 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LOT_1 Complement C1s subcomponent heavy chain (chains A)
CSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNC
LDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPC
PKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKC
QPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVL
GPELPKCVP

Primary citation

Structural basis of the C1q/C1s interaction and its central role in assembly of the C1 complex of complement activation. Venkatraman Girija, U., Gingras, A.R., Marshall, J.E. et al. Proc Natl Acad Sci U S A (2013) 110:13916-13920. DOI 10.1073/pnas.1311113110 · PubMed

Other PDB entries of the same protein (UniProt P09871 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NZI 1.5 Å, Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s
1ELV 1.7 Å, Crystal structure of the catalytic domain of human complement C1S protease
8TYP 1.8 Å, Complement Protease C1s Inhibited by 6-(4-phenylpiperazin-1-yl)pyridine-3-carboximidamide
4LOS 2.0 Å, C1s CUB2-CCP1
4LOR 2.5 Å, C1s CUB1-EGF-CUB2 in complex with a collagen-like peptide from C1q
5UBM 2.5 Å, Crystal structure of human C1s in complex with inhibitor gigastasin
8GMN 2.6 Å, Crystal structure of human C1s in complex with inhibitor
9X1H 2.6 Å, Cryo-EM Structure of human complement C1s CUB domain in complex with RAY121
4J1Y 2.66 Å, The X-ray crystal structure of human complement protease C1s zymogen
4LMF 2.92 Å, C1s CUB1-egf-CUB2
8W18 3.94 Å, The crystal structure of the Michaelis-Menten complex of a C1s/C1-INH at 3.94 Angstroms
6F1C 4.2 Å, C1rC1s complex

Browse structure collections

About this viewer

MolViewer shows 4LOT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.