Crystal structure of elongation factor G (EFG). Determined by X-ray diffraction at 2.95 Å resolution. Released 6 Aug 2014.
Explore 4M1K in 3D Show helices and sheets RCSB PDB PDBe
4M1K contains 28 α-helices and 43 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-11 | 3 | |
| β-strand | 12-18 | 7 | 1 |
| α-helix | 25-35 | 11 | |
| β-strand | 69-74 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 91-98 | 8 | |
| β-strand | 103-109 | 7 | 1 |
| β-strand | 113 | 1 | 1 |
| α-helix | 116-127 | 12 | |
| β-strand | 132-137 | 6 | 1 |
| α-helix | 146-157 | 12 | |
| β-strand | 161-163 | 3 | 1 |
| β-strand | 165-168 | 4 | 2 |
| β-strand | 176-179 | 4 | 2 |
| β-strand | 184-188 | 5 | 2 |
| β-strand | 196-199 | 4 | 2 |
| α-helix | 200-202 | 3 | |
| α-helix | 203-205 | 3 | |
| α-helix | 206-220 | 15 | |
| α-helix | 225-232 | 8 | |
| α-helix | 235-238 | 4 | |
| α-helix | 239-251 | 13 | |
| β-strand | 256-260 | 5 | 1 |
| β-strand | 262 | 1 | 3 |
| β-strand | 267 | 1 | 3 |
| α-helix | 269-279 | 11 | |
| α-helix | 281-282 | 2 | |
| α-helix | 287-289 | 3 | |
| β-strand | 290-292 | 3 | 4 |
| β-strand | 298-300 | 3 | 4 |
| β-strand | 310-319 | 10 | 5 |
| β-strand | 323-332 | 10 | 5 |
| β-strand | 335-336 | 2 | 6 |
| β-strand | 340-343 | 4 | 5 |
| β-strand | 348-358 | 11 | 5 |
| β-strand | 363-366 | 4 | 5 |
| β-strand | 368-369 | 2 | 6 |
| β-strand | 374-379 | 6 | 5 |
| α-helix | 387 | 1 | |
| β-strand | 388-390 | 3 | 5 |
| β-strand | 398 | 1 | 4 |
| α-helix | 404-406 | 3 | |
| β-strand | 409-412 | 4 | 7 |
| β-strand | 413-414 | 2 | 8 |
| α-helix | 421-431 | 11 | |
| β-strand | 439-442 | 4 | 7 |
| β-strand | 449-453 | 5 | 7 |
| α-helix | 456-467 | 12 | |
| β-strand | 475-476 | 2 | 8 |
| β-strand | 480-481 | 2 | 7 |
| β-strand | 484-486 | 3 | 9 |
| β-strand | 491-499 | 9 | 10 |
| β-strand | 506-516 | 11 | 10 |
| α-helix | 517 | 1 | |
| β-strand | 523-527 | 5 | 10 |
| α-helix | 539-549 | 11 | |
| α-helix | 558-559 | 2 | |
| β-strand | 560 | 1 | 9 |
| β-strand | 563-571 | 9 | 10 |
| β-strand | 577 | 1 | 10 |
| α-helix | 579-596 | 18 | |
| β-strand | 600-613 | 14 | 9 |
| α-helix | 614-616 | 3 | |
| α-helix | 617-626 | 10 | |
| β-strand | 630-635 | 6 | 9 |
| β-strand | 640-648 | 9 | 9 |
| α-helix | 649-651 | 3 | |
| α-helix | 655-660 | 6 | |
| β-strand | 668-678 | 11 | 9 |
| α-helix | 679-680 | 2 | |
| α-helix | 681-687 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Elongation factor G | A | protein | 691 | Thermus thermophilus | P13551 (AlphaFold model) |
>4M1K_1 Elongation factor G (chains A) MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE RGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV LRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEE ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD QEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQ VAYRETITKPVDVEGKFIRLTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPV ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR SKTQGRGSFVMFFDHYQEVPKQVQEKLIKGQ
Crystal structure of elongation factor G (EFG). Liu, G., Dong, J., Gong, W. et al. To be published.
Other PDB entries of the same protein (UniProt P13551 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4M1K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.